[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : hprK
DDBJ      :hprK         probable HPr Ser/Thr protein kinase/phosphatase
Swiss-Prot:HPRK_CLOPE   RecName: Full=HPr kinase/phosphorylase;         Short=HPrK/P;         EC=2.7.11.-;         EC=2.7.4.-;AltName: Full=HPr(Ser) kinase/phosphorylase;

Homologs  Archaea  0/68 : Bacteria  332/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.25.1c.91.1c.98.2
:307 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->284 1ko7A PDBj 2e-53 42.5 %
:RPS:SCOP  2->130 2iojA1  c.98.2.2 * 5e-18 18.6 %
:RPS:SCOP  126->256 2ib0A1  a.25.1.9 * 2e-04 10.9 %
:HMM:SCOP  2->129 1ko7A1 c.98.2.1 * 4.8e-37 42.2 %
:HMM:SCOP  130->298 1ko7A2 c.91.1.2 * 1.6e-38 36.3 %
:RPS:PFM   3->126 PF02603 * Hpr_kinase_N 2e-31 50.4 %
:RPS:PFM   131->280 PF07475 * Hpr_kinase_C 8e-48 54.7 %
:HMM:PFM   128->296 PF07475 * Hpr_kinase_C 3.3e-72 55.4 168/171  
:HMM:PFM   2->126 PF02603 * Hpr_kinase_N 3.6e-48 53.2 124/127  
:BLT:SWISS 1->307 HPRK_CLOPE e-168 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80710.1 GT:GENE hprK GT:PRODUCT probable HPr Ser/Thr protein kinase/phosphatase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1208552..1209475 GB:FROM 1208552 GB:TO 1209475 GB:DIRECTION + GB:GENE hprK GB:PRODUCT probable HPr Ser/Thr protein kinase/phosphatase GB:NOTE 307 aa, similar to gpu:AP001519_105 HPr (Ser/Thr) protein kinase/phosphatase from Bacillus halodurans (310 aa); 45% identity in 282 aa overlap CPE1004 GB:PROTEIN_ID BAB80710.1 LENGTH 307 SQ:AASEQ MGVTIEKLIKDFSLEVIQIGEENVPINVSDVNRPGLQLAGFYNYFAPERIQVIGKAEWSFLEDMSPDLRKKRLNKFFSFDISCLIITRGLEIHEELLKAARKRNLWILRSDMVTTKFISKITMYLSDKMAPETRLHGVLVDVYGIGMLITGESGIGKSETALELIKRGHRLVTDDAVDIKEIDGDLIGRSPEITFGMLEVRGMGIIDVSALYGLSSILNSKQIKIIIHFEHWKDDGDYDRLGVNDEYQDILGVKVKKLRVPIRPGRNIAVIIEAAAANYRYQRMSDISPVDIIEKRMLESMEKESKI GT:EXON 1|1-307:0| SW:ID HPRK_CLOPE SW:DE RecName: Full=HPr kinase/phosphorylase; Short=HPrK/P; EC=2.7.11.-; EC=2.7.4.-;AltName: Full=HPr(Ser) kinase/phosphorylase; SW:GN Name=hprK; OrderedLocusNames=CPE1004; SW:KW ATP-binding; Carbohydrate metabolism; Complete proteome; Kinase;Magnesium; Metal-binding; Multifunctional enzyme; Nucleotide-binding;Serine/threonine-protein kinase; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->307|HPRK_CLOPE|e-168|100.0|307/307| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005975|"GO:carbohydrate metabolic process"|Carbohydrate metabolism| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0004674|"GO:protein serine/threonine kinase activity"|Serine/threonine-protein kinase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 268->277|iaviieaaaa| BL:PDB:NREP 1 BL:PDB:REP 3->284|1ko7A|2e-53|42.5|268/285| RP:PFM:NREP 2 RP:PFM:REP 3->126|PF02603|2e-31|50.4|123/127|Hpr_kinase_N| RP:PFM:REP 131->280|PF07475|8e-48|54.7|150/157|Hpr_kinase_C| HM:PFM:NREP 2 HM:PFM:REP 128->296|PF07475|3.3e-72|55.4|168/171|Hpr_kinase_C| HM:PFM:REP 2->126|PF02603|3.6e-48|53.2|124/127|Hpr_kinase_N| GO:PFM:NREP 10 GO:PFM GO:0000155|"GO:two-component sensor activity"|PF02603|IPR011126| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF02603|IPR011126| GO:PFM GO:0004672|"GO:protein kinase activity"|PF02603|IPR011126| GO:PFM GO:0005524|"GO:ATP binding"|PF02603|IPR011126| GO:PFM GO:0006109|"GO:regulation of carbohydrate metabolic process"|PF02603|IPR011126| GO:PFM GO:0000155|"GO:two-component sensor activity"|PF07475|IPR011104| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF07475|IPR011104| GO:PFM GO:0004672|"GO:protein kinase activity"|PF07475|IPR011104| GO:PFM GO:0005524|"GO:ATP binding"|PF07475|IPR011104| GO:PFM GO:0006109|"GO:regulation of carbohydrate metabolic process"|PF07475|IPR011104| RP:SCP:NREP 2 RP:SCP:REP 2->130|2iojA1|5e-18|18.6|118/120|c.98.2.2| RP:SCP:REP 126->256|2ib0A1|2e-04|10.9|128/142|a.25.1.9| HM:SCP:REP 2->129|1ko7A1|4.8e-37|42.2|128/129|c.98.2.1|1/1|HPr kinase/phoshatase HprK N-terminal domain| HM:SCP:REP 130->298|1ko7A2|1.6e-38|36.3|168/0|c.91.1.2|1/1|PEP carboxykinase-like| OP:NHOMO 335 OP:NHOMOORG 334 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1---------------111111111111------------------------------------------------------111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11--------1---1111-1-1--1111----------------------------------------------------11--------11111-1------------------------------------------------11-11111111111111111111111111111111111111111111111111111111111111111111111---------------1111111-11111111--------------------------11---------------------------------1-11---------------------------------------------------------------------------------------------11111-----------------------------------------------------------------------------11111111111111---1111111---------11----1-1-1-111---11111-111----------111 -------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 95.4 SQ:SECSTR ##ccHHHHHHHHTcEEEE#cGGTcccccccEEccHHHHTTccTTccTTcEEEEcHHHHHHHHHccHHHHTTHHHHHccTTcccEEEcTTccccHHHHHHHHHTTccEEEccccHHHHHHHHHHHHHHHTcEEEEEEcEEEEETTEEEEEEEcTTccHHHHHHHHHHTTcEEEEccEEEEEEccccEEEEccGGGTTEEEETTTEEEEHHHHHcGGGcccEEEccEEEEEEEccTTccccccccccEEEEETTEEEEEEEEEccccccHHHHHHHHHHHHHHHHTTccHHHHHHHHH########### DISOP:02AL 300-307| PSIPRED ccEEHHHHHHHHccEEEEccccccEEEEccccccHHHHHHHHcccccccEEEEEHHHHHHHHcccHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHccEEEEEEEEEEEccEEEEEEccccccHHHHHHHHHHHcccEEEccEEEEEEcccccEEEccHHHHccEEEcccccccHHHHHccHHcccccEEEEEEEEEccccccccccccccHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccc //