[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : hydG
DDBJ      :hydG         probable hydrogenase gamma chain
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  226/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.43.4c.25.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->253 1ep1B PDBj 4e-15 28.5 %
:RPS:PDB   1->214 2bgjA PDBj 6e-21 15.9 %
:RPS:SCOP  1->91 1ep1B1  b.43.4.2 * 4e-13 27.8 %
:RPS:SCOP  107->258 1ep1B2  c.25.1.3 * 2e-28 31.3 %
:HMM:SCOP  1->93 1ep3B1 b.43.4.2 * 1.4e-18 38.0 %
:HMM:SCOP  88->258 1ep3B2 c.25.1.3 * 6.2e-36 35.9 %
:RPS:PFM   223->252 PF10418 * DHODB_Fe-S_bind 4e-05 56.7 %
:HMM:PFM   110->204 PF00175 * NAD_binding_1 4.4e-18 37.2 94/109  
:HMM:PFM   221->256 PF10418 * DHODB_Fe-S_bind 6.1e-14 38.9 36/40  
:HMM:PFM   2->91 PF00970 * FAD_binding_6 2e-05 25.8 89/99  
:BLT:SWISS 1->295 YADH_CLOBE e-124 68.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80961.1 GT:GENE hydG GT:PRODUCT probable hydrogenase gamma chain GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1463050..1463949) GB:FROM 1463050 GB:TO 1463949 GB:DIRECTION - GB:GENE hydG GB:PRODUCT probable hydrogenase gamma chain GB:NOTE 299 aa, similar to pir:F75069 hydrogenase, chain gamma related protein PAB1737 from Pyrococcus abyssi (strain Orsay) (278 aa); 51.5% identity in 272 aa overlap. 1 putative transmembrane region was found by PSORT CPE1255 GB:PROTEIN_ID BAB80961.1 LENGTH 299 SQ:AASEQ MFKILEKRYLNDSVYLMKIEAPRVANKAKPGQFIILRTDEGGERIPLTIADYNKEDKSVTIVVQGLGASTLELGKYNEGDYIHDFLGPLGRESDFIYEDLEELKKERILFVAGGVGAAPVYPQVKWLYNHGILADVIVGARNKELLIFEKELREVSKNLYIATDDGSYGFKGRVTDLLEDMVKNKGINYNRAIVIGPMIMMKFMCILTKELNIPTTVSLNPIMVDGTGMCGACRVTVGGEVKFACVDGPEFNGHLVDFDESIRRQAIYKTEEGRAFLKLKEGNTHSHGGCGCRGDLKNE GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 1->295|YADH_CLOBE|e-124|68.5|295/296| BL:PDB:NREP 1 BL:PDB:REP 1->253|1ep1B|4e-15|28.5|242/261| RP:PDB:NREP 1 RP:PDB:REP 1->214|2bgjA|6e-21|15.9|208/260| RP:PFM:NREP 1 RP:PFM:REP 223->252|PF10418|4e-05|56.7|30/38|DHODB_Fe-S_bind| HM:PFM:NREP 3 HM:PFM:REP 110->204|PF00175|4.4e-18|37.2|94/109|NAD_binding_1| HM:PFM:REP 221->256|PF10418|6.1e-14|38.9|36/40|DHODB_Fe-S_bind| HM:PFM:REP 2->91|PF00970|2e-05|25.8|89/99|FAD_binding_6| RP:SCP:NREP 2 RP:SCP:REP 1->91|1ep1B1|4e-13|27.8|90/101|b.43.4.2| RP:SCP:REP 107->258|1ep1B2|2e-28|31.3|147/160|c.25.1.3| HM:SCP:REP 1->93|1ep3B1|1.4e-18|38.0|92/0|b.43.4.2|1/1|Riboflavin synthase domain-like| HM:SCP:REP 88->258|1ep3B2|6.2e-36|35.9|156/0|c.25.1.3|1/1|Ferredoxin reductase-like, C-terminal NADP-linked domain| OP:NHOMO 422 OP:NHOMOORG 265 OP:PATTERN --211-----------1------1--------111111111111222222222133333411-12-1- -1----------------------1---------------1-----------------------------11------2121-1211122212222-----------------------------22223222323-----222-----1--------------------------------------222-111111111111111111111111111---1--111111--1--------------1----2----------------1-----111-------11111111111111-------------111111111-2112533333334352322344325211-223112543222323421111-11---------1-------22112----------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------3222122111111-2121122311111--32---------------------------1-----------------1-----------------1---------------------------1-----------------------1111111111111111-----------------------------------------------------------------------------1---------------------------------------------1-2--------------11-------------------1------2121111111--- -----------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 253 STR:RPRED 84.6 SQ:SECSTR EEEEEEEEEEETTEEEEEEEccTTcccccTTcEEEEEEEcTTccEEEEccccTTccEEEEEEEcTTcTTHHHHTTccTTcEEEEEEEEEccccGTTcccGGcccccEEEEEEEGGGGHHHHHHTTcHHHHHHccEEEEEEccTTTTHHHHHHHHHHHHcHHHHHHTcccEEEEEEHHHHHHTcccccTTTEEEEEEcHHHHHHHHHHHHHTTccTTccHHHHHHHccccccTTEEEcccTTccETTTccEEET############################################## DISOP:02AL 295-299| PSIPRED cEEEEEEEEEcccEEEEEEEccccccccccccEEEEEEcccccEEEEEEEcccccccEEEEEEEEEccHHHHHHccccccEEEEEEccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHccccEEEEEcccccccccccEEEEEEccccEEEEEEcccEEcHHHccHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccc //