[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : ilvE
DDBJ      :ilvE         branched-chain-amino-acid transaminase
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  714/915 : Eukaryota  190/199 : Viruses  0/175   --->[See Alignment]
e.17.1
:341 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->337 3dtgA PDBj 5e-55 37.8 %
:RPS:PDB   2->340 3dtgA PDBj e-117 39.8 %
:RPS:SCOP  7->340 1ekfA  e.17.1.1 * 1e-93 29.1 %
:HMM:SCOP  2->338 1ekfA_ e.17.1.1 * 1.1e-101 38.8 %
:RPS:PFM   75->297 PF01063 * Aminotran_4 5e-33 41.6 %
:HMM:PFM   75->322 PF01063 * Aminotran_4 4.5e-33 25.8 225/232  
:BLT:SWISS 7->341 ILVE_HAEIN e-147 72.2 %
:PROS 221->250|PS00770|AA_TRANSFER_CLASS_4

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81226.1 GT:GENE ilvE GT:PRODUCT branched-chain-amino-acid transaminase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1778114..1779139 GB:FROM 1778114 GB:TO 1779139 GB:DIRECTION + GB:GENE ilvE GB:PRODUCT branched-chain-amino-acid transaminase GB:NOTE 341 aa, similar to sp:ILVE_HAEIN BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE (EC 2.6.1.42) (BCAT) from Haemophilus influenzae (strain Rd KW20) (343 aa); 72.2% identity in 335 aa overlap CPE1520 GB:PROTEIN_ID BAB81226.1 LENGTH 341 SQ:AASEQ MDKKTAIDWNNLGFSYMKTDYRYISHYKDGKWDEGKLVTDNKLSISEASTALHYGQQCFEGLKAYRTKDGKIQLFRVDENAKRMNKSCDKLLMPEIPVEKFIDACMQVVKANERFVPPYGTGATLYIRPFMIGVGDNIGVKSAPEFIFSVFCLPVGAYFKGGMKPVNFMIADYDRAAPKGTGAAKVGGNYAASLKAHEIAAKKGFADCIYLDPATHTKIEEVGAANFFGITKKGEFVTPYSESILPSITKYSLMQIAKDYLKMPVSERDVLIDNLDEFAEAGACGTAAVITPIGGIEYKNKLHVFHSETEVGPITKKLYDLLSGMQFGDVEAPEGWIFEVK GT:EXON 1|1-341:0| BL:SWS:NREP 1 BL:SWS:REP 7->341|ILVE_HAEIN|e-147|72.2|335/343| PROS 221->250|PS00770|AA_TRANSFER_CLASS_4|PDOC00618| BL:PDB:NREP 1 BL:PDB:REP 11->337|3dtgA|5e-55|37.8|325/363| RP:PDB:NREP 1 RP:PDB:REP 2->340|3dtgA|e-117|39.8|337/363| RP:PFM:NREP 1 RP:PFM:REP 75->297|PF01063|5e-33|41.6|209/220|Aminotran_4| HM:PFM:NREP 1 HM:PFM:REP 75->322|PF01063|4.5e-33|25.8|225/232|Aminotran_4| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01063|IPR001544| GO:PFM GO:0008152|"GO:metabolic process"|PF01063|IPR001544| RP:SCP:NREP 1 RP:SCP:REP 7->340|1ekfA|1e-93|29.1|330/365|e.17.1.1| HM:SCP:REP 2->338|1ekfA_|1.1e-101|38.8|335/365|e.17.1.1|1/1|D-aminoacid aminotransferase-like PLP-dependent enzymes| OP:NHOMO 1290 OP:NHOMOORG 922 OP:PATTERN ------------------111----11-1-11111-----111---1------------------111 1111111111111111111-1111111111111111113111111111111111111111121121121111111111111111111111111111-1111121121112---------------111111--1112222211121211111111111111111111---1111111111111111-1-----2---------------111112-------111111111111111111111111111111111-11112-1-11--11-1-1111111111111111111111111111111111111111111111111111111----1--1111-1121111-1-1-111----1------------111-1112111111111211111111----------1-11111111111-1--111111111111111121111111111111111111111-------------1111111111111----11121111111222122311111111111111111211111113111111111111111-111-1111111--11121111111111111111111111112212112111111111111111111111111-1111111-1111111111111211112122122---11-1------11111111111111111-1111111111111111111111111211111111111111111111111111-11111111111111-------------111111111-1111111111111111111-1111111111111-111111-111111-1111111111111111111111111111-1-111111----------1-------------------------------------- ----111-21212223463633557542222122323332222222433643954333333321111122211122212212222211-23342421212313334-27122421441212121932624O2-335122152221111-121111112222111112111722212222H2222255548845421213 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 340 STR:RPRED 99.7 SQ:SECSTR #HHHHHHHHHccccccccccEEEEEEETTTEEEEEEEEEcccccccTTcTHHHHccEEEccEEEEEcTTccEEEEcHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHHHGGGccccccccEEEEEEEEEEcccccccccccEEEEEEEEEEEccccTTccccEEEEEcccccccTTccTTcccHHHHHHHHHHHHHHHHTTccEEEEEcTTTcccEEEETTEEEEEEGGGcEEEEcccccccccHHHHHHHHHHHHHHTcEEEEccccHHHHHHHHEEEEEETTTEEEEEEEEEETTEEEEcTTTccccHHHHHHHHHHHHHHTTccccTTccEEEcc DISOP:02AL 1-3| PSIPRED cccccccccccccccEEEcccEEEEEEccccEEccEEEcccccEEcHHHHHHHHccEEEEEEEEEEcccccEEEEcHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEcccccccccccccEEEEEEEcccccHHHHcccEEEEEEEcEEccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccEEEEEcccEEEEEEcccEEEcccccccccHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHEEEEccccEEEEEEEEEcccccEEEEccccccHHHHHHHHHHHHHHHccccccccccEEEEc //