[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : ipk
DDBJ      :ipk          isopentenyl monophosphate kinase
Swiss-Prot:ISPE_CLOPE   RecName: Full=4-diphosphocytidyl-2-C-methyl-D-erythritol kinase;         Short=CMK;         EC=2.7.1.148;AltName: Full=4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase;

Homologs  Archaea  0/68 : Bacteria  676/915 : Eukaryota  18/199 : Viruses  0/175   --->[See Alignment]
d.14.1d.58.26
:288 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->210 1oj4A PDBj 3e-22 33.2 %
:RPS:PDB   26->235 2a5zA PDBj 1e-33 8.3 %
:RPS:SCOP  2->156 1oj4A1  d.14.1.5 * 6e-56 39.6 %
:RPS:SCOP  159->284 1oj4A2  d.58.26.5 * 1e-13 16.4 %
:HMM:SCOP  2->169 1fi4A1 d.14.1.5 * 2e-45 34.9 %
:HMM:SCOP  159->284 1uekA2 d.58.26.5 * 3.6e-28 40.0 %
:RPS:PFM   85->142 PF00288 * GHMP_kinases_N 4e-04 37.9 %
:HMM:PFM   196->271 PF08544 * GHMP_kinases_C 7.5e-13 32.4 74/82  
:HMM:PFM   84->141 PF00288 * GHMP_kinases_N 9.9e-10 25.9 58/68  
:HMM:PFM   163->221 PF08862 * DUF1829 0.00099 24.6 57/88  
:BLT:SWISS 1->288 ISPE_CLOPE e-156 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81918.1 GT:GENE ipk GT:PRODUCT isopentenyl monophosphate kinase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2532078..2532944) GB:FROM 2532078 GB:TO 2532944 GB:DIRECTION - GB:GENE ipk GB:PRODUCT isopentenyl monophosphate kinase GB:NOTE 288 aa, similar to sp:IPK_BACSU ISOPENTENYL MONOPHOSPHATE KINASE (EC 2.7.1.-) from Bacillus subtilis (289 aa); 41.2% identity in 284 aa overlap CPE2212 GB:PROTEIN_ID BAB81918.1 LENGTH 288 SQ:AASEQ MKMKAYAKINIALDAIGKREDNYHLLRMIMQTVDLYDVIDIEKSNDSNISISCNKHYVSTDERNLAYKAAVLFRDEFNIKDGVKINIKKNIPVAAGMAGGSTNAAAVLVIMNKLFNVNASLEVLKEIGLKIGADVPYCIEGGTALCEGIGEIITPLKPFENKILVVLKPNFGVSTKEVYTNLDINKIRKHVNIEGLIQAMENDDLDYVSKNMKNVLENVTLKKHTILKNIKEDMRKSGALGAMMSGSGPTVFAFFDDMLTAQRAFEFLKGKYKYSDVYITRTINSNNL GT:EXON 1|1-288:0| SW:ID ISPE_CLOPE SW:DE RecName: Full=4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Short=CMK; EC=2.7.1.148;AltName: Full=4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase; SW:GN Name=ispE; Synonyms=ipk; OrderedLocusNames=CPE2212; SW:KW ATP-binding; Complete proteome; Isoprene biosynthesis; Kinase;Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->288|ISPE_CLOPE|e-156|100.0|288/288| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0008299|"GO:isoprenoid biosynthetic process"|Isoprene biosynthesis| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 237->248|sgalgammsgsg| BL:PDB:NREP 1 BL:PDB:REP 7->210|1oj4A|3e-22|33.2|199/277| RP:PDB:NREP 1 RP:PDB:REP 26->235|2a5zA|1e-33|8.3|206/232| RP:PFM:NREP 1 RP:PFM:REP 85->142|PF00288|4e-04|37.9|58/68|GHMP_kinases_N| HM:PFM:NREP 3 HM:PFM:REP 196->271|PF08544|7.5e-13|32.4|74/82|GHMP_kinases_C| HM:PFM:REP 84->141|PF00288|9.9e-10|25.9|58/68|GHMP_kinases_N| HM:PFM:REP 163->221|PF08862|0.00099|24.6|57/88|DUF1829| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00288|IPR006204| GO:PFM GO:0016301|"GO:kinase activity"|PF00288|IPR006204| GO:PFM GO:0016310|"GO:phosphorylation"|PF00288|IPR006204| RP:SCP:NREP 2 RP:SCP:REP 2->156|1oj4A1|6e-56|39.6|154/163|d.14.1.5| RP:SCP:REP 159->284|1oj4A2|1e-13|16.4|110/120|d.58.26.5| HM:SCP:REP 2->169|1fi4A1|2e-45|34.9|166/188|d.14.1.5|1/1|Ribosomal protein S5 domain 2-like| HM:SCP:REP 159->284|1uekA2|3.6e-28|40.0|120/120|d.58.26.5|1/1|GHMP Kinase, C-terminal domain| OP:NHOMO 722 OP:NHOMOORG 694 OP:PATTERN -------------------------------------------------------------------- -11-111-------11111-111111111111111111111----111-11-111--1---1-11111-1-----111-1111-111111111111---------111111111111111--11111111111111-----111--111111111111111111111111111111111111111---11111111111111111111111111111111111111111111111111111111111-111111-1-11-1---111111111------1111111-11---------------1-11111-1---------111111111111111111111111111111111111111111111111-1--1---------------1111---111111111111---------111-11111111111-----1---1-11--111111111---111--111111111----------------111------111111111111111111111111111111111111111-11111111111111111111111111111111-1111-1----11--111111111------11111-111111-1--------1-1-1111111111111111111111111111111111--11111--11111111111111112111-11111121111111111111111212111111111111111111111111111111111111111-111---------111111111111222221121111--11111111111111111111111111111111-111111111111111-1111111111111111111111--------11-----------------------1111111-111111-1 ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------11-1G111111113-1111----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 274 STR:RPRED 95.1 SQ:SECSTR EEEEEEEEEEEEccccTcTTcGGGTHHHHHHHHTccccccccEEcEEEEEEccccTTccEETTEEEEEETTcEEcccEEETEEEccEEccccTTcEEEEEcGGccGGGccEEEEEEEccccccTTEEEEEEEEEcTTccccEEEEEEETTEEEEEEEETTEEEEEEEEEEEccTTcEEEEEEEcTTccEEEEEEETTccEEEEEEcccccccccTTEEEEEEEEEcccccEEEEEHTTccEEEEcTTccccEEEEEEGGGHHHHHHHHHHHHHH############## DISOP:02AL 286-288| PSIPRED cEEEccEEEEEEEEEEEEccccccHHHHHHHHcccccEEEEEEEcccEEEEEEcccccccccccHHHHHHHHHHHHccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccEEEEccEEEEEEcccEEEEcccccccEEEEEEccccccHHHHHHHccHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccEEEEEccccEEEEEEccHHHHHHHHHHHHHHccccEEEEEEEcccccc //