[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : jag
DDBJ      :jag          SpoIIIJ-associated protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  272/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.68.7
:207 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   19->207 3gkuA PDBj 1e-42 51.1 %
:RPS:PDB   137->207 2cpmA PDBj 2e-13 28.6 %
:RPS:SCOP  147->203 1mszA  d.68.7.1 * 1e-10 21.4 %
:HMM:SCOP  146->207 1mszA_ d.68.7.1 * 5.8e-09 36.1 %
:RPS:PFM   150->203 PF01424 * R3H 8e-08 54.7 %
:HMM:PFM   152->203 PF01424 * R3H 1.3e-17 39.2 51/55  
:HMM:PFM   137->161 PF06203 * CCT 0.00062 34.8 23/45  
:HMM:PFM   55->84 PF04684 * BAF1_ABF1 0.00085 40.0 30/496  
:BLT:SWISS 1->207 JAG_BACSU 5e-41 42.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82362.1 GT:GENE jag GT:PRODUCT SpoIIIJ-associated protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(3028641..3029264) GB:FROM 3028641 GB:TO 3029264 GB:DIRECTION - GB:GENE jag GB:PRODUCT SpoIIIJ-associated protein GB:NOTE 207 aa, similar to sp:JAG_BACSU JAG PROTEIN (SPOIIIJ ASSOCIATED PROTEIN) from Bacillus subtilis (208 aa); 42% identity in 207 aa overlap CPE2656 GB:PROTEIN_ID BAB82362.1 LENGTH 207 SQ:AASEQ MNTIEITGKTVEEALKSALEQLNTTEDKVEVTVIEEGSKGFFNLIGAKPAKISVKMKRDRILEAKKFLRDILDNMNIEAEINIEESKDLVNINLTGPKMGAIIGYRGETLDSLQYLTSLVVNKAKEDKYKRVVLDTENYRQKREETLKRLANKIAYKVRKSGKILKLEPMNPYERRVIHSELQNNDFVRTFSEGEEPYRRVVVELKK GT:EXON 1|1-207:0| BL:SWS:NREP 1 BL:SWS:REP 1->207|JAG_BACSU|5e-41|42.2|206/208| SEG 74->85|nmnieaeiniee| BL:PDB:NREP 1 BL:PDB:REP 19->207|3gkuA|1e-42|51.1|182/199| RP:PDB:NREP 1 RP:PDB:REP 137->207|2cpmA|2e-13|28.6|70/94| RP:PFM:NREP 1 RP:PFM:REP 150->203|PF01424|8e-08|54.7|53/56|R3H| HM:PFM:NREP 3 HM:PFM:REP 152->203|PF01424|1.3e-17|39.2|51/55|R3H| HM:PFM:REP 137->161|PF06203|0.00062|34.8|23/45|CCT| HM:PFM:REP 55->84|PF04684|0.00085|40.0|30/496|BAF1_ABF1| GO:PFM:NREP 1 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF01424|IPR001374| RP:SCP:NREP 1 RP:SCP:REP 147->203|1mszA|1e-10|21.4|56/62|d.68.7.1| HM:SCP:REP 146->207|1mszA_|5.8e-09|36.1|61/0|d.68.7.1|1/1|R3H domain| OP:NHOMO 272 OP:NHOMOORG 272 OP:PATTERN -------------------------------------------------------------------- -1-11-------1-111----11111-----11---1111111111--1---111-----111111-1111111111111111-----------------------------------------------------11111111111111--1----------11111111------------111--11111111111111111111111111111111111--111111111-------------------1-1-11-1---11111111-------111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111-----------1--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111-------------------------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 88.4 SQ:SECSTR ##################HHHHTccGGGEEEEEEEcccccc###cccccEEEEEEEcccHHHHHHHHHHHHHHHTccEEEEEEETTTT#EEEEEEcHH#HHccTTHHHHHHHHHHHHHHHHHHTccc#ccEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHTcEEEEEcccccccEEEEEcc PSIPRED ccEEEEEEccHHHHHHHHHHHHcccHHEEEEEEEEEccccHHHHccccEEEEEEEEccccHHHHHHHHHHHHHHccccEEEEEEEEccEEEEEEccccHHHHHcccccHHHHHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHccccEEEEEcccccEEEEEEEcc //