[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : lacA
DDBJ      :lacA         galactose-6-phosphate isomerase
Swiss-Prot:LACA_CLOPE   RecName: Full=Galactose-6-phosphate isomerase subunit lacA;         EC=5.3.1.26;

Homologs  Archaea  0/68 : Bacteria  491/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
c.121.1
:142 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->138 1nn4D PDBj 5e-21 38.0 %
:RPS:PDB   2->134 3c5yH PDBj 2e-09 15.5 %
:RPS:SCOP  1->141 1uslA  c.121.1.1 * 8e-23 34.8 %
:HMM:SCOP  1->141 1uslA_ c.121.1.1 * 3.2e-45 45.4 %
:RPS:PFM   2->138 PF02502 * LacAB_rpiB 2e-25 40.1 %
:HMM:PFM   2->139 PF02502 * LacAB_rpiB 1.8e-41 40.6 138/140  
:BLT:SWISS 1->142 LACA_CLOPE 2e-76 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80032.1 GT:GENE lacA GT:PRODUCT galactose-6-phosphate isomerase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 411556..411984 GB:FROM 411556 GB:TO 411984 GB:DIRECTION + GB:GENE lacA GB:PRODUCT galactose-6-phosphate isomerase GB:NOTE 142 aa, similar to sp:LACA_STRMU GALACTOSE-6-PHOSPHATE ISOMERASE LACA SUBUNIT (EC 5.3.1.26) from Streptococcus mutans (142 aa); 66% identity in 141 aa overlap CPE0326 GB:PROTEIN_ID BAB80032.1 LENGTH 142 SQ:AASEQ MRVVIGADKEGMELKNMIKCYLLENNFEVIDKSEEASEDFVESTVAITKDVLENKGSLGIAFDGYGAGSFMVATKIKGIIAAEVSDERSAYMTREHNNSSIITIGSKIVGSELALNIVKEFLEASYDGGRHQIRVDMLNKMA GT:EXON 1|1-142:0| SW:ID LACA_CLOPE SW:DE RecName: Full=Galactose-6-phosphate isomerase subunit lacA; EC=5.3.1.26; SW:GN Name=lacA; OrderedLocusNames=CPE0326; SW:KW Complete proteome; Isomerase; Lactose metabolism. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->142|LACA_CLOPE|2e-76|100.0|142/142| GO:SWS:NREP 2 GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| GO:SWS GO:0005988|"GO:lactose metabolic process"|Lactose metabolism| BL:PDB:NREP 1 BL:PDB:REP 2->138|1nn4D|5e-21|38.0|137/159| RP:PDB:NREP 1 RP:PDB:REP 2->134|3c5yH|2e-09|15.5|129/204| RP:PFM:NREP 1 RP:PFM:REP 2->138|PF02502|2e-25|40.1|137/140|LacAB_rpiB| HM:PFM:NREP 1 HM:PFM:REP 2->139|PF02502|1.8e-41|40.6|138/140|LacAB_rpiB| GO:PFM:NREP 1 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02502|IPR003500| RP:SCP:NREP 1 RP:SCP:REP 1->141|1uslA|8e-23|34.8|141/156|c.121.1.1| HM:SCP:REP 1->141|1uslA_|3.2e-45|45.4|141/157|c.121.1.1|1/1|Ribose/Galactose isomerase RpiB/AlsB| OP:NHOMO 596 OP:NHOMOORG 505 OP:PATTERN -------------------------------------------------------------------- 1231111111111111111-111111111111111111111-111111111132211111-1121211111-------1111-111111111-111---111111111-2---------------11111111121-----1121-1-------------------1---------------------111-111111111111111112111111111111-1244454411111111111111111322211---11--1------22-------311121111222111111111112222222222222111---211211143111111111122111211111212111111111-111121111141121--------------------111111111111---1-----1-------11222122------------111--------1--1-112--11111111111111-111-11111111111-11------------1111----1111--------------1----1-1--1----------------------1-1-1111111111111112111111211-121111111111111111111111111----3----------------------------------------1-1-1--1--11111----111111-1--1-11111211111------------------------------11111111111-------------1--21---1---------11----------1-----------------1----------------------------------------11111111--------1-1----1-1-11111111-111111111111111111111 --------2111-----1--------------------------------1--1-----1111-1--------------------------------------------1---------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 99.3 SQ:SECSTR cEEEEcccGGGGGGHHHHHHHHGGGTcEEEEccTTccccccHHHHHHHHHHHHHccTcccEEEEEcccHHHHHHTTTTccEEEcccHHHHHHHHHHTcccEEEEccTTccTTHHHHHHHHHHHHcHccccccccHHHHTcc# PSIPRED cEEEEEEccHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHccccEEEEEEEcHHHHHHHHHHccccEEEEccEEccHHHHHHHHHHHHcccccccHHHHHHHHHHHcc //