[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : lacB
DDBJ      :lacB         galactose-6-phosphate isomerase
Swiss-Prot:LACB_CLOPE   RecName: Full=Galactose-6-phosphate isomerase subunit lacB;         EC=5.3.1.26;

Homologs  Archaea  2/68 : Bacteria  483/915 : Eukaryota  40/199 : Viruses  0/175   --->[See Alignment]
c.121.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->128 2vvrB PDBj 7e-24 40.2 %
:RPS:PDB   2->126 3c5yH PDBj 3e-10 18.9 %
:RPS:SCOP  1->126 1nn4A  c.121.1.1 * 2e-22 39.7 %
:HMM:SCOP  1->155 1uslA_ c.121.1.1 * 2.4e-51 43.2 %
:RPS:PFM   2->128 PF02502 * LacAB_rpiB 1e-31 48.8 %
:HMM:PFM   2->142 PF02502 * LacAB_rpiB 2.1e-44 47.9 140/140  
:BLT:SWISS 1->171 LACB_CLOPE 3e-85 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80033.1 GT:GENE lacB GT:PRODUCT galactose-6-phosphate isomerase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 412020..412535 GB:FROM 412020 GB:TO 412535 GB:DIRECTION + GB:GENE lacB GB:PRODUCT galactose-6-phosphate isomerase GB:NOTE 171 aa, similar to sp:LACB_STAAU GALACTOSE-6-PHOSPHATE ISOMERASE LACB SUBUNIT (EC 5.3.1.26) from Staphylococcus aureus (171 aa); 71.9% identity in 171 aa overlap CPE0327 GB:PROTEIN_ID BAB80033.1 LENGTH 171 SQ:AASEQ MKIAIGCDHIVTDTKIAVSDFLKAKGYDVLDVGTYDFTRTHYPIFGKKVGEAVASGEADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTAIYAKEQLNANVIGFGGKITGEFLMCDIIEAFIKADYIENEENKKIINKINSLEENKPEQNDIHFFDEFLERWNRGEYKD GT:EXON 1|1-171:0| SW:ID LACB_CLOPE SW:DE RecName: Full=Galactose-6-phosphate isomerase subunit lacB; EC=5.3.1.26; SW:GN Name=lacB; OrderedLocusNames=CPE0327; SW:KW Complete proteome; Isomerase; Lactose metabolism. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->171|LACB_CLOPE|3e-85|100.0|171/171| GO:SWS:NREP 2 GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| GO:SWS GO:0005988|"GO:lactose metabolic process"|Lactose metabolism| SEG 129->148|ieneenkkiinkinsleenk| BL:PDB:NREP 1 BL:PDB:REP 2->128|2vvrB|7e-24|40.2|127/146| RP:PDB:NREP 1 RP:PDB:REP 2->126|3c5yH|3e-10|18.9|122/204| RP:PFM:NREP 1 RP:PFM:REP 2->128|PF02502|1e-31|48.8|127/140|LacAB_rpiB| HM:PFM:NREP 1 HM:PFM:REP 2->142|PF02502|2.1e-44|47.9|140/140|LacAB_rpiB| GO:PFM:NREP 1 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02502|IPR003500| RP:SCP:NREP 1 RP:SCP:REP 1->126|1nn4A|2e-22|39.7|126/159|c.121.1.1| HM:SCP:REP 1->155|1uslA_|2.4e-51|43.2|155/157|c.121.1.1|1/1|Ribose/Galactose isomerase RpiB/AlsB| OP:NHOMO 620 OP:NHOMOORG 525 OP:PATTERN --1-------------1--------------------------------------------------- 1231111111111111111-11111211111112221111----1211111-322111---1122211211-------1111-111111111-1-----111111111-2---------------11111111121111--1121-1-------------------1--1------------------111-111111111111111112111111111111-1244454411111111111111111211111---11--1------11-------211121111211111111111112222222222222121---322211133111111111122111211111212111111111-111121111141121--------------------111111111111---1-----1---1---11222122------------111--------1--1-113---1111111--1111-111111111111111111------------1111----1111--------------1----1-1--1------------------------111-11111111111112111111211-1211111-----111111111111111----3----------------------------------------1-1-1--1--11111----111111-1--1-11111211111--1---------------------------11111111111-------------1--21---2-1-------11----------1-----------------1----------------------------------------11111111--------1-1----1-1-1111111111-1111111111111111111 --------2111--1111--------1---------11111111----1---1-111111111-2---------1-----------------1-1-1111--1------1---------------------------------------------------------------------------1---1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 74.9 SQ:SECSTR cEEEEcccGGGGGGHHHHHHHHGGGTcEEEEccccTTccccccHHHHHHHHHHHHHTccEccEEEEEcccHHHHHTTTTTccEEEcccHHHHHHHHHHTcccEEEEccTTccTTHHHHHHHHHHHHcc########################################### DISOP:02AL 146-150| PSIPRED cEEEEEccHHHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHcccccEEEEEEEcHHHHHHHHHHcccEEEEEccEEccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccc //