[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : ldhD
DDBJ      :ldhD         D-lactate dehydrogenase
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  784/915 : Eukaryota  184/199 : Viruses  1/175   --->[See Alignment]
c.2.1c.23.12c.91.1
:332 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->331 1xdwA PDBj e-105 54.1 %
:RPS:PDB   3->331 3ba1A PDBj 4e-65 25.2 %
:RPS:SCOP  46->332 1aq2A1  c.91.1.1 * 5e-37 11.1 %
:HMM:SCOP  1->140 2dldA2 c.23.12.1 * 6e-38 36.0 %
:HMM:SCOP  102->302 1dxyA1 c.2.1.4 * 1.3e-50 32.7 %
:RPS:PFM   35->324 PF00389 * 2-Hacid_dh 9e-29 34.2 %
:HMM:PFM   111->300 PF02826 * 2-Hacid_dh_C 5.6e-51 38.9 175/178  
:BLT:SWISS 2->323 LDHD_LACPL 1e-57 38.5 %
:PROS 149->176|PS00065|D_2_HYDROXYACID_DH_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80236.1 GT:GENE ldhD GT:PRODUCT D-lactate dehydrogenase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 659756..660754 GB:FROM 659756 GB:TO 660754 GB:DIRECTION + GB:GENE ldhD GB:PRODUCT D-lactate dehydrogenase GB:NOTE 332 aa, similar to sp:LDHD_ECOLI D-LACTATE DEHYDROGENASE (EC 1.1.1.28) (D-LDH) from Escherichia coli (329 aa); 36.4% identity in 330 aa overlap CPE0530 GB:PROTEIN_ID BAB80236.1 LENGTH 332 SQ:AASEQ MIKLVCYGVRETEVPYFHKLNEEFGYDLTLVEKNLNHENVEEAIGAEAIMVRGNCMADRQNLELLKSKGLKYVLTRTVGFDHVDLDAAKDLGLQVARVPGYSPNAIGELAVSLAMMLLRHTAYTTNRTSNKNFVVDGFMFSKEIRNCTVGILGAGRIGLTTAKLFKGLGAKVVAYDVFQSDAAKEIVEFMPLDEVLKVSDVISVHMPYIKGQNYHMINEEFISKMKNDAIIINTARGELQDIEAIVKALEEGRLGGFGADVLEGESAVFFKNLEGQKLENESYEKLISLYPRALVTPHMGSYTDEALRNMIGISYENLKEYLEGNTCKNAIA GT:EXON 1|1-332:0| BL:SWS:NREP 1 BL:SWS:REP 2->323|LDHD_LACPL|1e-57|38.5|317/332| PROS 149->176|PS00065|D_2_HYDROXYACID_DH_1|PDOC00063| BL:PDB:NREP 1 BL:PDB:REP 2->331|1xdwA|e-105|54.1|329/331| RP:PDB:NREP 1 RP:PDB:REP 3->331|3ba1A|4e-65|25.2|310/312| RP:PFM:NREP 1 RP:PFM:REP 35->324|PF00389|9e-29|34.2|272/300|2-Hacid_dh| HM:PFM:NREP 1 HM:PFM:REP 111->300|PF02826|5.6e-51|38.9|175/178|2-Hacid_dh_C| GO:PFM:NREP 3 GO:PFM GO:0008152|"GO:metabolic process"|PF00389|IPR006139| GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF00389|IPR006139| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF00389|IPR006139| RP:SCP:NREP 1 RP:SCP:REP 46->332|1aq2A1|5e-37|11.1|262/310|c.91.1.1| HM:SCP:REP 1->140|2dldA2|6e-38|36.0|139/0|c.23.12.1|1/1|Formate/glycerate dehydrogenase catalytic domain-like| HM:SCP:REP 102->302|1dxyA1|1.3e-50|32.7|199/199|c.2.1.4|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 3924 OP:NHOMOORG 1036 OP:PATTERN 22211131111111113222311241111231111111222212121112221233333332112-22 136-311122211133322-231145222223222221772212221-1111563221--323134545613222333113232233344441344---23423344514------------------211--12-21144111232312442112211111123223332111111221122211224422233333333323333334354333332334711333334232666666666666668555522553347121444435-416972223331-----------------1----111111-12111111111361674444444243235532225321132241671111221288421332144334-1--147CA93235868444444443445-66466459773-9AA44474448D9643132656687342222222232211322-----------------------------122422253277998952444466996666568597797-46544445373748954212--12112222244312133221--22112221222222346333222242222222222221222222222332224454633333444444454444444454441-12224------45544444445465644-44456554544644444446B756334444444444444444455544444116555555555551-2322222333213456222334-3323322222432352336366565797465763655112123111323344444444444222313311211112213222233--------11-------1---2------11------3243323222222 ----372-21--24268978767A9A75655667775A789796678557AEEF68764444D3522213245344525568869733-8E685649987615555-344CA97AA411-23415C-D4AT7-668-42194253-333-51154B56934524633E58822643534t33437D7BI79755F9FE1 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- STR:NPRED 332 STR:RPRED 100.0 SQ:SECSTR ccccEEEEcccccHHHHHHHHHHcEEEEGGGcccHHHHHHHHTTTEEEEEEcccccccHHHHHHcHcTTccEEEEcccccTTccHHHHHHHTcEEEccccTTHHHHHHHHHHHHHHHHTTHHHHHHHHHTTGGGGcccccccccTTccEEEEcccHHHHHHHHHHHTTTccEEEEcccccTTccccEEEccHHHHHHTccEEEEcccccGcGGTTcccHHHHHHHcTTcEEEEcccGGGccHHHHHHHHHHTcccEEEEcccTTTTcccGGGGGHcccccHHHGGGGGccTTEEEccccTTccHHHHHHHHHHHHHHHHHHHHTcccccccH DISOP:02AL 330-332| PSIPRED ccEEEEEcccHHHHHHHHHHHHHcccEEEEccccccHHHHHHHccccEEEEcccccccHHHHHHHcccccEEEEEEccccccccHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEcHHHHHHHHHHHHcccEEEEEccccccHHHHccccccHHHHHHHccEEEEEcccccccccccccHHHHHHccccEEEEEccccccccHHHHHHHHHcccEEEEEEEcccccccccccccccccccccccHHHHHHcccEEEccccccccHHHHHHHHHHHHHHHHHHHcccccccccc //