[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : metS.1
DDBJ      :metS         probable methionine-tRNA ligase
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  909/915 : Eukaryota  196/199 : Viruses  1/175   --->[See Alignment]
a.27.1c.26.1
:514 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->497 1rqgA PDBj 5e-80 34.1 %
:RPS:PDB   2->513 2d54A PDBj 8e-61 22.9 %
:RPS:SCOP  2->350 1a8hA2  c.26.1.1 * 2e-45 24.0 %
:RPS:SCOP  352->512 1rqgA1  a.27.1.1 * 1e-20 30.4 %
:HMM:SCOP  2->350 2d5bA2 c.26.1.1 * 6e-83 32.9 %
:HMM:SCOP  355->511 1qqtA1 a.27.1.1 * 8.6e-32 31.2 %
:RPS:PFM   4->361 PF09334 * tRNA-synt_1g 3e-66 37.2 %
:RPS:PFM   387->466 PF08264 * Anticodon_1 8e-07 27.5 %
:HMM:PFM   4->363 PF09334 * tRNA-synt_1g 7.4e-106 37.0 357/391  
:HMM:PFM   388->470 PF08264 * Anticodon_1 5.7e-11 19.5 82/152  
:BLT:SWISS 1->509 SYM1_ALKOO e-147 47.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82229.1 GT:GENE metS.1 GT:PRODUCT probable methionine-tRNA ligase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2887935..2889479) GB:FROM 2887935 GB:TO 2889479 GB:DIRECTION - GB:GENE metS GB:PRODUCT probable methionine-tRNA ligase GB:NOTE 514 aa, similar to sp:SYM_ARCFU METHIONYL-TRNA SYNTHETASE (EC 6.1.1.10) (METHIONINE-TRNA LIGASE) (METRS) from Archaeoglobus fulgidus (658 aa); 35.3% identity in 504 aa overlap CPE2523 GB:PROTEIN_ID BAB82229.1 LENGTH 514 SQ:AASEQ MKVIIGNAWPYANGSLHIGRVSSWMAGDILARYHRAKGDEVIFVSGSDCHGSPILNKAKEINKSPEELINKYHREFVRCFNKLGFSFNIFTRTDSEYHEKQVKNIIKSLYNKGFIYEKETEEFYCPKCCDTLDEFGIKEGLCNECNSKVEVRSSNNLFFKLSYFQDYIQNILDEEESWRENAIKITKRYLEGGLRDKILTREINWGIEVPIEGFEDKRVYVWIDALLAYVTASKKVIEEKGQSLEEYWNNEDSRIYLVHGKENIPFHTTMFPAILSGIGLEKSEIRIFSSQYLTLEGKTFSTNRNWAIWVPYIMERYNIDSIRYYLISRGAEEKNSDFTWRDFINANNNELVGEIGNFTNRVLTFIKKNFSGEIKGEELPLQWKNLIRRTYASVGNKFENGEFKSGVKEMFNLIKQGNDFFDKNKPWILINNNKKKCEEVLYICSQILVALTDLMNPIIPFTCEKIKMFLGIKDTKWSFKERKNIRVNRVEFLFDKIDKKVAIEELNRLKNKKI GT:EXON 1|1-514:0| BL:SWS:NREP 1 BL:SWS:REP 1->509|SYM1_ALKOO|e-147|47.2|508/540| BL:PDB:NREP 1 BL:PDB:REP 1->497|1rqgA|5e-80|34.1|496/606| RP:PDB:NREP 1 RP:PDB:REP 2->513|2d54A|8e-61|22.9|490/500| RP:PFM:NREP 2 RP:PFM:REP 4->361|PF09334|3e-66|37.2|349/363|tRNA-synt_1g| RP:PFM:REP 387->466|PF08264|8e-07|27.5|80/153|Anticodon_1| HM:PFM:NREP 2 HM:PFM:REP 4->363|PF09334|7.4e-106|37.0|357/391|tRNA-synt_1g| HM:PFM:REP 388->470|PF08264|5.7e-11|19.5|82/152|Anticodon_1| GO:PFM:NREP 12 GO:PFM GO:0000166|"GO:nucleotide binding"|PF09334|IPR015413| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF09334|IPR015413| GO:PFM GO:0005524|"GO:ATP binding"|PF09334|IPR015413| GO:PFM GO:0005737|"GO:cytoplasm"|PF09334|IPR015413| GO:PFM GO:0006412|"GO:translation"|PF09334|IPR015413| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF09334|IPR015413| GO:PFM GO:0000166|"GO:nucleotide binding"|PF08264|IPR013155| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF08264|IPR013155| GO:PFM GO:0005524|"GO:ATP binding"|PF08264|IPR013155| GO:PFM GO:0005737|"GO:cytoplasm"|PF08264|IPR013155| GO:PFM GO:0006412|"GO:translation"|PF08264|IPR013155| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF08264|IPR013155| RP:SCP:NREP 2 RP:SCP:REP 2->350|1a8hA2|2e-45|24.0|342/348|c.26.1.1| RP:SCP:REP 352->512|1rqgA1|1e-20|30.4|161/210|a.27.1.1| HM:SCP:REP 2->350|2d5bA2|6e-83|32.9|340/0|c.26.1.1|1/1|Nucleotidylyl transferase| HM:SCP:REP 355->511|1qqtA1|8.6e-32|31.2|157/160|a.27.1.1|1/1|Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases| OP:NHOMO 2413 OP:NHOMOORG 1174 OP:PATTERN 11212211111111112233223333332323222322333332333223222322222222212111 2222211111111111111-11111111111111111111211122111113222222113122311121211111114223222222111111111-11111111112122222222222222222211122211111222222222122211111222111111111221222222222222222222222233333332233333322222233322232232222222422222222222222222222221122112222211112221222222222222222222322322222222222222222222222222222423222222222232222333133222212222222232322222322231222222222223222222222122222222222-22222222232242223324422222222212222222222222222212212212222222222222212222222222323221222211111111111112211121222211111111111111111222221111112222112222222111222222222222222222222222222334325222222222222223222222222222112221221211122222222222222222222-2221123222222322222222222222-22322222222222222222222223222222222222222222222222221222222222222222222222322212212222222222222222222222211122222232221222213332221222221222222222222221111111111111121231111112222222222111112-21212211112212221113233322232211 2111321-41112221222333333432234344543444444222223332322324333322233223322223222222333224-23223332222212333132373222362221132643427L41445421352352232134124233334844443-224B43223222X2222343342223332222 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 514 STR:RPRED 100.0 SQ:SECSTR EEEEEEEEEEETTccccHHHHHHHHHHHHHHHHHHHTTcEEEEEEEEEcccHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHTTccccEEEETTcHHHHHHHHHHHHHHHHTTcEEEEEEEEEEETTTTEEEcTTTccTTccTTTccccEEEEEEEEEEcGGGGHHHHHHHHHcTTccccHHHHHHHHHHTTcccccEEcEEETTTcccccTTEEEEEEcHHHHHHTHHHHTTTTTTcHHEHTTHHHHHHHGGGEEEEEEGGGHHHHHTHHHHHHHHHTcccccEEEEEccEEcTTcccccGGGTccccHHHHHHHHcHHHHHHHHHHHccTTccEEccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcTTccccGGGGTGGGGHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHTTTcHHHHHHHHHHTTcccccHHHTTccccccGGGGGcccccccccccccccccccccc PSIPRED cEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccEEEccEEEEccccccccccHHHHHHcccccccccEEEEEcccEEEEcHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEccHHHHHHHcccccccccccccccccccccccEEEEcccccccHHHHHHHHHHHHccccccccEEEEEEEEEcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHcccc //