[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : metS.2
DDBJ      :metS         methionine-tRNA ligase
Swiss-Prot:SYM_CLOPE    RecName: Full=Methionyl-tRNA synthetase;         EC=6.1.1.10;AltName: Full=Methionine--tRNA ligase;         Short=MetRS;

Homologs  Archaea  68/68 : Bacteria  910/915 : Eukaryota  194/199 : Viruses  1/175   --->[See Alignment]
a.27.1b.40.4c.26.1
:645 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->506 2ct8A PDBj e-116 49.1 %
:BLT:PDB   540->635 1pybA PDBj 2e-21 56.4 %
:RPS:PDB   19->476 2d5bA PDBj 3e-83 44.5 %
:RPS:PDB   538->644 2cwpA PDBj 1e-25 37.4 %
:RPS:SCOP  19->349 1a8hA2  c.26.1.1 * 8e-67 48.9 %
:RPS:SCOP  350->506 1a8hA1  a.27.1.1 * 7e-28 29.3 %
:RPS:SCOP  538->635 1pxfA  b.40.4.4 * 3e-29 35.7 %
:HMM:SCOP  2->349 2d5bA2 c.26.1.1 * 2.3e-119 42.9 %
:HMM:SCOP  351->558 1rqgA1 a.27.1.1 * 3.9e-43 34.2 %
:HMM:SCOP  538->645 1pybA_ b.40.4.4 * 9.5e-37 55.1 %
:RPS:PFM   20->361 PF09334 * tRNA-synt_1g e-110 58.6 %
:RPS:PFM   396->485 PF08264 * Anticodon_1 2e-09 41.4 %
:RPS:PFM   550->643 PF01588 * tRNA_bind 8e-13 46.8 %
:HMM:PFM   6->362 PF09334 * tRNA-synt_1g 2.1e-136 52.3 352/391  
:HMM:PFM   550->641 PF01588 * tRNA_bind 4.3e-31 57.6 92/95  
:HMM:PFM   395->469 PF08264 * Anticodon_1 2.9e-08 24.0 75/152  
:BLT:SWISS 1->645 SYM_CLOPE 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82230.1 GT:GENE metS.2 GT:PRODUCT methionine-tRNA ligase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2889580..2891517) GB:FROM 2889580 GB:TO 2891517 GB:DIRECTION - GB:GENE metS GB:PRODUCT methionine-tRNA ligase GB:NOTE 645 aa, similar to gpu:AP001507_53 methionyl-tRNA synthetase from Bacillus halodurans (660 aa); 59.8% identity in 630 aa overlap CPE2524 GB:PROTEIN_ID BAB82230.1 LENGTH 645 SQ:AASEQ MCKKPYYITTPIYYPSTNLHIGNTYTTVAADAIARFKRLTGHEVMFLTGTDEHGQKIERIANEKGITPKEHVDEIVAGIKDLWKMMNISYDKFIRTTDDYHVKAVQEIFKKLYDQGDIYKDSYEGLYCTPCESFWTETQLVNGNCPDCGRPVEKAKEEAYFFKMSKYADRLIQYIEEHPDFIQPESRKNEMLNNFLRPGLQDLCVSRTSFTWGIPVSFDEKHVIYVWIDALSNYITALGYGQENQELYKKFWPADVHLIGKDILRFHTIYWPIMLMALGLELPKQVFGHGWLLVDGGKMSKSKGNVVDPVVLVNMFGADAVRYYLLREIPFGSDGLFNNEIFIKKVNTDLANDLGNLLSRTIAMVYKYFGGVIQAPTCKEPIDDELINLALSTPGKVEASIDALKIPEALESIWTLISRANKYIDETTPWILAKDEEKKERLGTVLYNLLETLRFVSVMISPFLTETSVKINAQLNTKVTTWESLKEFNGTVAGDKVVKGDVIFPRIDVEEKLAELEALKPAPVKPANEELVENPIKEEITIDDFDKIDLRVVKVLECEPVKKAKKLLKLKVDLGGEERQVISGIAQYYKPEELVGKYVVLVANLKPVKLRGELSQGMILAAAPSDDSELLLVNPGEMLTGSQVR GT:EXON 1|1-645:0| SW:ID SYM_CLOPE SW:DE RecName: Full=Methionyl-tRNA synthetase; EC=6.1.1.10;AltName: Full=Methionine--tRNA ligase; Short=MetRS; SW:GN Name=metG; Synonyms=metS; OrderedLocusNames=CPE2524; SW:KW Aminoacyl-tRNA synthetase; ATP-binding; Complete proteome; Cytoplasm;Ligase; Metal-binding; Nucleotide-binding; Protein biosynthesis;RNA-binding; tRNA-binding; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->645|SYM_CLOPE|0.0|100.0|645/645| GO:SWS:NREP 9 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| SEG 5->15|pyyittpiyyp| SEG 510->523|eeklaelealkpap| SEG 562->571|kkakkllklk| BL:PDB:NREP 2 BL:PDB:REP 20->506|2ct8A|e-116|49.1|440/465| BL:PDB:REP 540->635|1pybA|2e-21|56.4|94/107| RP:PDB:NREP 2 RP:PDB:REP 19->476|2d5bA|3e-83|44.5|449/500| RP:PDB:REP 538->644|2cwpA|1e-25|37.4|107/109| RP:PFM:NREP 3 RP:PFM:REP 20->361|PF09334|e-110|58.6|336/363|tRNA-synt_1g| RP:PFM:REP 396->485|PF08264|2e-09|41.4|87/153|Anticodon_1| RP:PFM:REP 550->643|PF01588|8e-13|46.8|94/100|tRNA_bind| HM:PFM:NREP 3 HM:PFM:REP 6->362|PF09334|2.1e-136|52.3|352/391|tRNA-synt_1g| HM:PFM:REP 550->641|PF01588|4.3e-31|57.6|92/95|tRNA_bind| HM:PFM:REP 395->469|PF08264|2.9e-08|24.0|75/152|Anticodon_1| GO:PFM:NREP 13 GO:PFM GO:0000166|"GO:nucleotide binding"|PF09334|IPR015413| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF09334|IPR015413| GO:PFM GO:0005524|"GO:ATP binding"|PF09334|IPR015413| GO:PFM GO:0005737|"GO:cytoplasm"|PF09334|IPR015413| GO:PFM GO:0006412|"GO:translation"|PF09334|IPR015413| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF09334|IPR015413| GO:PFM GO:0000166|"GO:nucleotide binding"|PF08264|IPR013155| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF08264|IPR013155| GO:PFM GO:0005524|"GO:ATP binding"|PF08264|IPR013155| GO:PFM GO:0005737|"GO:cytoplasm"|PF08264|IPR013155| GO:PFM GO:0006412|"GO:translation"|PF08264|IPR013155| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF08264|IPR013155| GO:PFM GO:0000049|"GO:tRNA binding"|PF01588|IPR002547| RP:SCP:NREP 3 RP:SCP:REP 19->349|1a8hA2|8e-67|48.9|329/348|c.26.1.1| RP:SCP:REP 350->506|1a8hA1|7e-28|29.3|150/152|a.27.1.1| RP:SCP:REP 538->635|1pxfA|3e-29|35.7|98/111|b.40.4.4| HM:SCP:REP 2->349|2d5bA2|2.3e-119|42.9|345/0|c.26.1.1|1/1|Nucleotidylyl transferase| HM:SCP:REP 351->558|1rqgA1|3.9e-43|34.2|202/210|a.27.1.1|1/1|Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases| HM:SCP:REP 538->645|1pybA_|9.5e-37|55.1|107/0|b.40.4.4|1/1|Nucleic acid-binding proteins| OP:NHOMO 2883 OP:NHOMOORG 1173 OP:PATTERN 22233233333333332222222232222324212111222222222231122134423233224112 2242211122112122222-21222122222211111222312122111223222222114222411121211111112323333322111111111-11111112113132222223233333334443344443322323333322222223322111111231211223122333131232224434343355555554355555533333355533345242222223433333333333333333333333222233233333223333232333333333333333433433333333333333333333333333334533444333343433443444333553233333333344332233333231333211121223222232222222222222222132233123331242224434413333133213232212122222222322132322222111132222212122222222222333313322221111111123321122333321112111111111122222222221112211112222222221221433323232232332232332333334334232222222222232333333322222223221221111122222222222222222222-2112111122222222223333333233-33433333333333333322222223222222222222222222323222321222222222222322211111222221212222222222222222111111211121222232222222223332221222221333422222232331111111111222221242233223333333343323322-22332422112311232222333333333321 2211332-41224351232333323332235344443333333323223333332324333323333223332233323322334313-2522333222333245313526432433112-241423223H2-223311131231-222222244214422444621326E45214334h3444444563326443223 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 630 STR:RPRED 97.7 SQ:SECSTR ###############cccccHHHHHHHHHHHHHHHHHHHTTcEEEEEEEEEcccHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHTTccccEEEETTcHHHHHHHHHHHHHHHHTTcEEEEEEEEEEETTTTEEccTTTccTTccTTTccccEEEEEEEEEEcGGGGHHHHHHHHHTcTTcEEcHHHHHHHHHHTcccccEEcEEETTTcccccEETTEEEEEEcHHHHHHTHHHHTTTTTTcHHHcHHHHGGGEEEEEEGGGHHHHHTHHHHHHHHHTcccccEEEEEcEEcTTcccccTTTTccccHHHHHHHHcHHHHHHHHHHHccTTccEEccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcTTcccccccccccccGGGGGGGGHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcHcHHHHHHHHHHHHHHHHHHHHHHTTTcHHHHHHHHHHTTccccccccccccTTccccEEccccccccccccHGGEEEEETTEEEEEEEEcccccHHHHHHHHHTTccccHHHHHcccccEEEEETTcTTcEEEEEEccccEEEEEEccTTTccGTTccTTcEEEEEccccEEETTEEEccEEcEEcccccccTTccccccccTTcEEc DISOP:02AL 516-533| PSIPRED cccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEcccccccHHHHHHHccccccccccEEEEEEcccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccEEcccccccEEccccccccccccHHHHHHHHHHcccccccHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHHHHcccccHHEEEEEEEEEcccHHHHcccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccccEEEEccHHHccHHHHcccEEEEEEcccccHHHHHcccEEEEEEEccccEEEEEEcccccccccccc //