[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : mreC
DDBJ      :mreC         cell-shape determining protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  358/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:283 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   93->276 2j5uA PDBj 3e-26 33.0 %
:RPS:PFM   121->271 PF04085 * MreC 2e-22 37.4 %
:HMM:PFM   119->273 PF04085 * MreC 4.4e-39 34.9 152/154  
:HMM:PFM   48->108 PF06109 * HlyE 9.7e-05 31.1 61/299  
:BLT:SWISS 93->271 MREC_BACSU 5e-17 28.5 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81848.1 GT:GENE mreC GT:PRODUCT cell-shape determining protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2453680..2454531) GB:FROM 2453680 GB:TO 2454531 GB:DIRECTION - GB:GENE mreC GB:PRODUCT cell-shape determining protein GB:NOTE 283 aa, similar to gpu:AP001517_152 cell-shape determining protein from Bacillus halodurans (293 aa); 26% identity in 269 aa overlap. Putative N-terminal signal sequence was found by PSORT CPE2142 GB:PROTEIN_ID BAB81848.1 LENGTH 283 SQ:AASEQ MKFFKNKLAVTVIVLSVAFLGIIIFTVKSDSKNPISGGVGTVLNPVQKVVYTISDKVHDVFDFFYNFSDVKNENNDLKKKNLELENQLVEYNELKRQNDVLRGIVDFSKENNQYKYIGTNIIGKSGNSFVEGYTIDKGSSEGIKKDYIVISPEGLVGVVTEVHSNWSKIQTLLNENVAVAATIEGDSNSGDGIVKGYRNGSEMQAEITNLPMNSTIKEGETVVTSGLGGYYPKGIRIGEVTSVQSDDVKVMKTAILKTYVDFNNLQELFVVVPPSERDGIVKY GT:EXON 1|1-283:0| BL:SWS:NREP 1 BL:SWS:REP 93->271|MREC_BACSU|5e-17|28.5|179/290| COIL:NAA 32 COIL:NSEG 3 COIL:REGION 66->94| COIL:REGION 96->96| COIL:REGION 99->100| TM:NTM 1 TM:REGION 8->29| SEG 69->90|dvknenndlkkknlelenqlve| BL:PDB:NREP 1 BL:PDB:REP 93->276|2j5uA|3e-26|33.0|182/210| RP:PFM:NREP 1 RP:PFM:REP 121->271|PF04085|2e-22|37.4|147/152|MreC| HM:PFM:NREP 2 HM:PFM:REP 119->273|PF04085|4.4e-39|34.9|152/154|MreC| HM:PFM:REP 48->108|PF06109|9.7e-05|31.1|61/299|HlyE| GO:PFM:NREP 1 GO:PFM GO:0008360|"GO:regulation of cell shape"|PF04085|IPR007221| OP:NHOMO 360 OP:NHOMOORG 358 OP:PATTERN -------------------------------------------------------------------- 11----------------------------------------------------------------------------11111----1111-11-----111111-11-1---------------11111111111----------111-11-11------------11--------------1-------1111111111111111211111111121111111111111111111111111111111111111111111111111111111111111-------11111111111111-------------1--111----11111111111111111111111111111111111111111111111-1--------------------------------------------------------------------------------------------1----------111111111111111----------11111--------------1---------1111-1111-----111---11-111111-------11--111111-111111-----1-11--111111-111---------------------------11111111-1-1------------------1-1--1-------1-1-1-1------------------------------11111111----------------1-------11111111111111--1-------------1-1111111----1111-------111-1--------------------------1111-1111111111--11111---11111--111----11111111-1------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 65.0 SQ:SECSTR ############################################################################################HHHHHHHHHHHHTTccccTTcEEEEEEEEEEccGGGTTTEEEEcccGGGTccTTcEEEETTEEEEEEEEEccccEEEEETTcccTTEEEEEcccccEEEEEEEEEETTTTETEEEEEEETTccccTTcEEEEccTTccccTTcEEEEEEEEEEcTTccEEEEEEEEccccccccEEEEEEEccc####### DISOP:02AL 275-283| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEcccccEEEEEEEcccccccccccEEEccccEEEEEEEEEccEEEEEEEEccccEEEEEEEEccccEEEEEEEcccccccEEEEEEcccccccccccEEEEcccccccccccEEEEEEEEEEcccccEEEEEEEEEEcccccEEEEEEEccccccccccc //