[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : murF
DDBJ      :murF         UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate-D-alanyl-D-alanyl ligase
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  865/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.59.1c.72.2c.98.1
:453 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->450 1gg4A PDBj 1e-44 33.5 %
:RPS:PDB   5->446 1e8cB PDBj 9e-71 15.4 %
:RPS:SCOP  2->106 1gg4A3  c.98.1.1 * 7e-22 33.0 %
:RPS:SCOP  109->317 1gg4A4  c.72.2.1 * 1e-36 31.3 %
:RPS:SCOP  320->450 1gg4A1  c.59.1.1 * 4e-20 33.3 %
:HMM:SCOP  1->106 1gg4A3 c.98.1.1 * 9.9e-22 34.7 %
:HMM:SCOP  107->317 1gg4A4 c.72.2.1 * 4.1e-51 35.1 %
:HMM:SCOP  318->451 1gg4A1 c.59.1.1 * 6.7e-37 39.4 %
:RPS:PFM   26->103 PF01225 * Mur_ligase 4e-07 34.7 %
:RPS:PFM   113->296 PF08245 * Mur_ligase_M 5e-21 36.8 %
:HMM:PFM   113->298 PF08245 * Mur_ligase_M 7.1e-45 36.8 185/188  
:HMM:PFM   319->398 PF02875 * Mur_ligase_C 3.1e-17 29.1 79/91  
:HMM:PFM   25->102 PF01225 * Mur_ligase 9.3e-14 29.3 75/76  
:BLT:SWISS 1->452 MURF_BACSU 3e-75 36.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81567.1 GT:GENE murF GT:PRODUCT UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate-D-alanyl-D-alanyl ligase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2129556..2130917) GB:FROM 2129556 GB:TO 2130917 GB:DIRECTION - GB:GENE murF GB:PRODUCT UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate-D-alanyl-D-alanyl ligase GB:NOTE 453 aa, similar to sp:MURF_BACSU UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMYL-2, 6-DIAMINOPIMELATE-D-ALANYL-D- ALANYL LIGASE (EC 6.3.2.15) (UDP-MURNAC-PENTAPEPTIDE SYNTHETASE) (D-ALANYL-D-ALANINE-ADDING ENZYME) from Bacillus subtilis (457 aa); 38.7% identity in 452 aa overlap CPE1861 GB:PROTEIN_ID BAB81567.1 LENGTH 453 SQ:AASEQ MLELNLQEIVKATKGALLKEADVKEIKAVSTDTRKIEEGTMFIALKGENFNGNNYVLDAFNKGAKIAIVDEVKCDLNELKEDVALIKVQNTGRALMDLAKFYREKLGLKVVGITGSAGKTSTKDLVAAVLSDKYKVFKTKGNFNNEIGLPLMILELDSTYDVAILEMGMRGLGQIKELAEIASPDLGIITNIGISHIEILKTRENILKAKMEIATFFDKNNTLVVCGNDDFLGALPEAEYKIVKTGVGENFKIGAKNIALEELSSKFTVYDGEKEEEFSLDMPGEHNISNLMLGIAIAKELGVSFEEMKRGLKNIEATSMRLELIKKDGFSILNDCYNSSPVAVKSAIDVMKNIEGKRRIAVLGTMRELGHKSEEAHEEIGKYAKENGIEKVLCFGNFSENIKEGYGEGCTVYENKEELIKDLLNIICDGDIILVKASRSLKFEEITKALLEK GT:EXON 1|1-453:0| BL:SWS:NREP 1 BL:SWS:REP 1->452|MURF_BACSU|3e-75|36.9|445/457| BL:PDB:NREP 1 BL:PDB:REP 2->450|1gg4A|1e-44|33.5|424/430| RP:PDB:NREP 1 RP:PDB:REP 5->446|1e8cB|9e-71|15.4|422/484| RP:PFM:NREP 2 RP:PFM:REP 26->103|PF01225|4e-07|34.7|75/76|Mur_ligase| RP:PFM:REP 113->296|PF08245|5e-21|36.8|182/187|Mur_ligase_M| HM:PFM:NREP 3 HM:PFM:REP 113->298|PF08245|7.1e-45|36.8|185/188|Mur_ligase_M| HM:PFM:REP 319->398|PF02875|3.1e-17|29.1|79/91|Mur_ligase_C| HM:PFM:REP 25->102|PF01225|9.3e-14|29.3|75/76|Mur_ligase| GO:PFM:NREP 4 GO:PFM GO:0005524|"GO:ATP binding"|PF01225|IPR000713| GO:PFM GO:0009058|"GO:biosynthetic process"|PF01225|IPR000713| GO:PFM GO:0005524|"GO:ATP binding"|PF08245|IPR013221| GO:PFM GO:0009058|"GO:biosynthetic process"|PF08245|IPR013221| RP:SCP:NREP 3 RP:SCP:REP 2->106|1gg4A3|7e-22|33.0|97/98|c.98.1.1| RP:SCP:REP 109->317|1gg4A4|1e-36|31.3|201/206|c.72.2.1| RP:SCP:REP 320->450|1gg4A1|4e-20|33.3|129/135|c.59.1.1| HM:SCP:REP 1->106|1gg4A3|9.9e-22|34.7|98/98|c.98.1.1|1/1|MurE/MurF N-terminal domain| HM:SCP:REP 107->317|1gg4A4|4.1e-51|35.1|211/214|c.72.2.1|1/1|MurD-like peptide ligases, catalytic domain| HM:SCP:REP 318->451|1gg4A1|6.7e-37|39.4|132/135|c.59.1.1|1/1|MurD-like peptide ligases, peptide-binding domain| OP:NHOMO 1398 OP:NHOMOORG 869 OP:PATTERN ---------------------------------1---------------------------------- 1122211111111111111-111111111111121211111112111111111111-1111111111111111111111112134333333323222--423221324222222222212111121122232222212212---211111111111111111111111111111122213212111112222222232323313332233322243331115122333332323222222222222224335311221111111111111113213111222211112211112121122111111111111111111111124674444433343224244454413322131324443323333333313312-111122211111111111211222212122224-11111111211221111111112211111112-1--111111111111111111111------112222333232232231111111-1121111111111111111111111111111111122111111111121212211122111111111131111243131233122223121221233111142321111111111111111111111111222311112121111111122111111121211-21211-2-1-111211121111111111-11111111111111111111111111111111111111111111111111111211111111111111222222223212222222111122222222222222111222222223332232332234333233333222222222222221111111111111122223311221112122211--------------------------1331212111212 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------4-----2------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 449 STR:RPRED 99.1 SQ:SECSTR #ccccHHHHHTTTcTTcTTccccccccccEccGGGccTTcEEEEcccccccGGGGHHHHHHTTcTTTccTTccccccEEETTEEEEEETTHHHHHHHHHHHHTTGGccEEEEHHHHTTccEEEcTTccEETTcccEcccccccccHHHHHHHHHHHHHTTccEEEEccHHHHTHHTTTTTTccccEEEEcccccccHHHHccHHHHHHHHHHGHTHcccccEEEEETTcHHHHHHTTcTTcEEEEccTccEEEEEEEEEEccccEEEEEEETTcccEEEEEcccHHHHHHHHHHHHHHHHTTccHHHHHHHGGGccccTTcEEEccTTccEEEEEEccccHHHHHHHHHHHHHTccccEEEEEccccccccTHHHHHHHHHHHccEEEEccccccTHHHHHHHTTccTTccEEccHHHHHHHHHHHccTTcEEEEEccTTccEEEEHHHH### DISOP:02AL 1-2| PSIPRED cccccHHHHHHHHccEEEcccccccccEEEccccccccccEEEEEccccccHHHHHHHHHHcccEEEEEEccccccccccccccEEEEccHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHcccccccEEEEEEEEHHccHHHHHHHHccccEEEEEcccHHHHHHcccHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHcccEEEEEEEccccEEEEEEEEEccccEEEEEEEccEEEEEEEccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEcccEEEEEEEccccHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHcccccEEEccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHcc //