[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : ndk
DDBJ      :ndk          nucleoside diphosphate kinase
Swiss-Prot:NDK_CLOPE    RecName: Full=Nucleoside diphosphate kinase;         Short=NDK;         Short=NDP kinase;         EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase;

Homologs  Archaea  64/68 : Bacteria  799/915 : Eukaryota  194/199 : Viruses  1/175   --->[See Alignment]
d.58.6
:143 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->139 2dyaB PDBj 2e-36 54.4 %
:RPS:PDB   4->142 2cwkB PDBj 5e-46 54.4 %
:RPS:SCOP  1->142 1b4sA  d.58.6.1 * 2e-42 37.4 %
:HMM:SCOP  1->136 1w7wA_ d.58.6.1 * 1.7e-50 49.3 %
:RPS:PFM   4->136 PF00334 * NDK 4e-35 51.9 %
:HMM:PFM   4->135 PF00334 * NDK 1e-55 58.3 132/135  
:BLT:SWISS 1->143 NDK_CLOPE 9e-79 100.0 %
:PROS 114->122|PS00469|NDP_KINASES

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81678.1 GT:GENE ndk GT:PRODUCT nucleoside diphosphate kinase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2260966..2261397) GB:FROM 2260966 GB:TO 2261397 GB:DIRECTION - GB:GENE ndk GB:PRODUCT nucleoside diphosphate kinase GB:NOTE 143 aa, similar to sp:NDK_METTH NUCLEOSIDE DIPHOSPHATE KINASE (EC 2.7.4.6) (NDK) (NDP KINASE) from Methanobacterium thermoautotrophicum (151 aa); 52.9% identity in 140 aa overlap CPE1972 GB:PROTEIN_ID BAB81678.1 LENGTH 143 SQ:AASEQ MRLEKSLVLIKPDAVERNLIGKILEVYEGAGLKIKAMEMKQINKEFAEKHYEEHRDKQFFNSLIKYITRSPLVALILEGEDAINKIRSLNGATNPEKAEFGTIRRRFALSGTENSVHASDSIESAEKEIKLWFPKVFYEEICG GT:EXON 1|1-143:0| SW:ID NDK_CLOPE SW:DE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP kinase; EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase; SW:GN Name=ndk; OrderedLocusNames=CPE1972; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Magnesium;Metal-binding; Nucleotide metabolism; Nucleotide-binding;Phosphoprotein; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->143|NDK_CLOPE|9e-79|100.0|143/143| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0009117|"GO:nucleotide metabolic process"|Nucleotide metabolism| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 114->122|PS00469|NDP_KINASES|PDOC00409| BL:PDB:NREP 1 BL:PDB:REP 4->139|2dyaB|2e-36|54.4|136/155| RP:PDB:NREP 1 RP:PDB:REP 4->142|2cwkB|5e-46|54.4|136/152| RP:PFM:NREP 1 RP:PFM:REP 4->136|PF00334|4e-35|51.9|133/134|NDK| HM:PFM:NREP 1 HM:PFM:REP 4->135|PF00334|1e-55|58.3|132/135|NDK| GO:PFM:NREP 5 GO:PFM GO:0004550|"GO:nucleoside diphosphate kinase activity"|PF00334|IPR001564| GO:PFM GO:0005524|"GO:ATP binding"|PF00334|IPR001564| GO:PFM GO:0006183|"GO:GTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006228|"GO:UTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006241|"GO:CTP biosynthetic process"|PF00334|IPR001564| RP:SCP:NREP 1 RP:SCP:REP 1->142|1b4sA|2e-42|37.4|139/150|d.58.6.1| HM:SCP:REP 1->136|1w7wA_|1.7e-50|49.3|136/0|d.58.6.1|1/1|Nucleoside diphosphate kinase, NDK| OP:NHOMO 1603 OP:NHOMOORG 1058 OP:PATTERN 11-1111111111111-1-111111111111111111111111111111111111111111111-111 1111111111111111111-111111111111111111111111111111111111111111111111111--------111111111111111--1--1-111111111111111111111112111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111113111111111111111111111-1-11-1---111111-1211----1111111---11111111111--------------111111111----1-------1-1--111111--1--1--1111111--111111-1--121111111111111111111111111111111111-1111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111-11111111111111111111111111111111111--1111------11111111111111111-111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111-11111111111111-1--------------------------11111-----111 2122434-61112251111111111111111111111111111111-1111111-111111111111111111111111111111111-111111122211136331344B8999CA4374481BB4C6XZE-C7C4536D43C956842725C4957799645581222113742443O2223295881583333332 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 143 STR:RPRED 100.0 SQ:SECSTR cTTEEEEEEEcHHHHHTTcHHHHHHHHHHHTcEEEEEEEEcccHHHHHHHTGGGTTcTTHHHHHHHHTcccEEEEEEEEETHHHHHHHHHccccGGGccTTcHHHHHccccccccEEEcccHHHHHHHHHHHccGTHHGGccc DISOP:02AL 143-144| PSIPRED ccccEEEEEEccHHHHcccHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHcccccHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccHHHcccccEEHHHccccccccccccccHHHHHHHHHHHccccccccccc //