[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : nirC
DDBJ      :nirC         probable nitrite transporter
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  311/915 : Eukaryota  64/199 : Viruses  0/175   --->[See Alignment]
:265 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PFM   26->212 PF01226 * Form_Nir_trans 1e-31 43.9 %
:HMM:PFM   7->250 PF01226 * Form_Nir_trans 1.7e-72 41.1 241/250  
:BLT:SWISS 27->231 NIRC_SALTY 4e-37 37.8 %
:PROS 159->169|PS01006|FORMATE_NITRITE_TP_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81148.1 GT:GENE nirC GT:PRODUCT probable nitrite transporter GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1700121..1700918) GB:FROM 1700121 GB:TO 1700918 GB:DIRECTION - GB:GENE nirC GB:PRODUCT probable nitrite transporter GB:NOTE 265 aa, similar to pir:S39703 nitrite transport protein homolog ywcJ from Bacillus subtilis (256 aa); 37.9% identity in 214 aa overlap. 7 putative transmembrane regions were found by PSORT. CPE1442 GB:PROTEIN_ID BAB81148.1 LENGTH 265 SQ:AASEQ MFREEFSNVISAGRGKIDLLNNSKGRYLVYAMLAGLYISFGIMLAFTIGGILDSANSPSTKIIMGASFGVALSLVVFAGSELFTGNNFVMTIGILNKEVTFKECGKVWGLAYAGNFLGSIIAALGFIGAGLTTGSVSDFMIKTAEIKISLPPEQLFIRGIFCNILVCLAVWCTFRLKTETSKLIMIFWCLFAFVTSGFEHSIANMSLLVIGVILTKGATITVAGSLYNLFFVTLGNILGGVLLGVTYHYIANKKVENKKLVHIQK GT:EXON 1|1-265:0| BL:SWS:NREP 1 BL:SWS:REP 27->231|NIRC_SALTY|4e-37|37.8|201/269| PROS 159->169|PS01006|FORMATE_NITRITE_TP_2|PDOC00769| TM:NTM 7 TM:REGION 30->52| TM:REGION 59->81| TM:REGION 111->133| TM:REGION 152->173| TM:REGION 178->200| TM:REGION 202->224| TM:REGION 229->251| SEG 232->245|vtlgnilggvllgv| RP:PFM:NREP 1 RP:PFM:REP 26->212|PF01226|1e-31|43.9|187/248|Form_Nir_trans| HM:PFM:NREP 1 HM:PFM:REP 7->250|PF01226|1.7e-72|41.1|241/250|Form_Nir_trans| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF01226|IPR000292| GO:PFM GO:0006810|"GO:transport"|PF01226|IPR000292| GO:PFM GO:0016020|"GO:membrane"|PF01226|IPR000292| OP:NHOMO 605 OP:NHOMOORG 390 OP:PATTERN ----------------1---------------1--1-111111-12-2---------112-------- ------1--------11---------------1-----------11--1----------------------------1-111------------11-------1------------------------------------------------------1-1--1---------------------------1113333333323333331-22-23321---112222222-1-111111111111111----3--------------------1-1111111111-11111111111111-1111111-111111---1111---111111111212-2---221-2---11---11--11--11--1--11-------------1-------1---------------------1------------------------1------2---------------1---------------------------------------1----------------------------------1---------1--1---1----------1--1-111----1--------11-1-1-------11-11-----------------1------2221-1--2-211111-1111111111111--1----------21111223332322233-3333322233323333332111111112222222222222222223322222-322222222222------------------222111111111111---1------11----1------1---11----------12332222223333--------------------------------1--------------------1-----------------1- 11------1-----1-1-21-212121-------------------11--2121-----11111111111-111111111111-11---1111-1-------1-----16------------------------------------------------------------------651G11132-------11----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 154 STR:RPRED 58.1 SQ:SECSTR EEEEEE##cccTTcccEEEEEccccTTcHHHHHHHcccHHHHHHHHHTTccTTcTTTccccTTTcccccEEEEEEEEccc###TTTTTccccE###EcccEEccccTTEEcccccccccEEcTTcccEEEEEEEEEccH##HHHHHHHHHHHHHcEEccccccH##################################################################################################### DISOP:02AL 258-265| PSIPRED cHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcc //