[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : nqrE
DDBJ      :nqrE         probable Na-translocating NADH-quinone reductase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  287/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:191 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->191 PF02508 * Rnf-Nqr 2e-41 56.5 %
:HMM:PFM   2->191 PF02508 * Rnf-Nqr 2.1e-71 54.5 187/190  
:BLT:SWISS 2->191 RNFA_AERHH 1e-56 55.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80770.1 GT:GENE nqrE GT:PRODUCT probable Na-translocating NADH-quinone reductase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1271741..1272316 GB:FROM 1271741 GB:TO 1272316 GB:DIRECTION + GB:GENE nqrE GB:PRODUCT probable Na-translocating NADH-quinone reductase GB:NOTE 191 aa, similar to pir:A72399 Na-translocating NADH-quinone reductase, Nqr5 subunit from Thermotoga maritima (strain MSB8) (213 aa); 54.6% identity in 194 aa overlap. Putative N-terminal signal sequence and 5 putative transmembrane regions were found by PSORT. CPE1064 Nqr5 subunit GB:PROTEIN_ID BAB80770.1 LENGTH 191 SQ:AASEQ MELFLIFIGAMLVNNFVLSQFLGICSFIGVSKKKEAAVGMGLAVTFVMVLASIISWLVYNLILDKFNITYLKTIVFVLVIASLVQFVEMVVKKYSPSLYKALGIFLPLITTNCAVLGMAVTNVEEVYNLIQSIVHALGAAGGYMLAIVLMSFLREKIDDNEEIHPYFRGLPITLFTAALMSIAFLGFQGLI GT:EXON 1|1-191:0| BL:SWS:NREP 1 BL:SWS:REP 2->191|RNFA_AERHH|1e-56|55.6|189/193| TM:NTM 6 TM:REGION 6->28| TM:REGION 38->60| TM:REGION 67->89| TM:REGION 100->122| TM:REGION 131->153| TM:REGION 168->190| RP:PFM:NREP 1 RP:PFM:REP 2->191|PF02508|2e-41|56.5|184/187|Rnf-Nqr| HM:PFM:NREP 1 HM:PFM:REP 2->191|PF02508|2.1e-71|54.5|187/190|Rnf-Nqr| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02508|IPR003667| OP:NHOMO 774 OP:NHOMOORG 290 OP:PATTERN -------------------------------------------------22----------------- --------------------------------------------------------------------------------2-------3333-433----2--22-----222222212222222---2-422-24----------------------------------------------------22--------------------------------------------------------------------------------------------------------------------------------------42-22222222-2--222222-22223222--------24--22---2---2------------------------------------------------------------------2222-22-------------2------------------------------------2---------------------------------------------------61-2--422222222--444-24532222-622---------2-------11---------------------------555444444445866645655566655655--4226222-11111121111111111111-1111111111111111111333224441111111111111111311111111-344444344444---4---------64424444444444443444-------221644434--1-3----6------------244444444444444--------------2212--------------2-2-------------------------4243324222--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 190-192| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccHHHHHHHHHHHHHHHHHcccc //