[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : pabA
DDBJ      :pabA         probable para-aminobenzoate synthase component II
Swiss-Prot:             

Homologs  Archaea  62/68 : Bacteria  845/915 : Eukaryota  164/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:196 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->186 1qdlB PDBj 9e-41 46.2 %
:RPS:PDB   1->161 3dkyE PDBj 3e-39 10.6 %
:RPS:SCOP  14->192 1a9xB2  c.23.16.1 * 6e-49 27.3 %
:HMM:SCOP  1->188 1qdlB_ c.23.16.1 * 1.8e-61 41.9 %
:RPS:PFM   4->184 PF00117 * GATase 5e-33 41.6 %
:HMM:PFM   4->186 PF00117 * GATase 2e-60 43.4 182/192  
:BLT:SWISS 1->186 TRPG_CYAPA 8e-59 55.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80722.1 GT:GENE pabA GT:PRODUCT probable para-aminobenzoate synthase component II GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1219810..1220400 GB:FROM 1219810 GB:TO 1220400 GB:DIRECTION + GB:GENE pabA GB:PRODUCT probable para-aminobenzoate synthase component II GB:NOTE 196 aa, similar to pir:H81135 para-aminobenzoate synthase glutamine amidotransferase component II NMB0966 from Neisseria meningitidis (196 aa); 53.4% identity in 191 aa overlap CPE1016 GB:PROTEIN_ID BAB80722.1 LENGTH 196 SQ:AASEQ MFLMIDNYDSFVFNLLRYFKELNEDIKIKRNDKITIEEIKKLNPEGIIISPGPKAPKDMKECLNIIEEFKGKIPILGVCLGHQCIGYSFGSKIKKGDFPVHGKVSKITHDGKGIFKGIKNNINVTRYHSLVVDRNFLGEDLEITALSDDGVVMGIRHKRYNIEGVQFHPEAVLTEYGHEMLKNFIDNARKFNIIER GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 1->186|TRPG_CYAPA|8e-59|55.4|186/190| BL:PDB:NREP 1 BL:PDB:REP 3->186|1qdlB|9e-41|46.2|182/195| RP:PDB:NREP 1 RP:PDB:REP 1->161|3dkyE|3e-39|10.6|160/180| RP:PFM:NREP 1 RP:PFM:REP 4->184|PF00117|5e-33|41.6|178/185|GATase| HM:PFM:NREP 1 HM:PFM:REP 4->186|PF00117|2e-60|43.4|182/192|GATase| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| RP:SCP:NREP 1 RP:SCP:REP 14->192|1a9xB2|6e-49|27.3|172/228|c.23.16.1| HM:SCP:REP 1->188|1qdlB_|1.8e-61|41.9|186/195|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 2707 OP:NHOMOORG 1071 OP:PATTERN 11-2--3333333332-33312234222442333333433333221232333332211211222--12 3331233333311211112-111111111111111123321111111-1221211111221112213221322222221--123433333322322-1121223222331---------1----133322323222322222232123533333333221112233356532232333232334444443-34444444444344444444444444444445554444444334444444444444444444221222232224433222323314444443333333333333333333333333333333322333222235-34111222121244443333313122333355333222434333-43224111222111223113321121133333333333-22222322124132223322332232222113222212122222222111-231311111111-----------------212132111212221111111211111111111111111111221111111222211221111221213333333112112244342322132211313221222223233342332244444212211211122212223343313343333333433333333333333-1212212111344443444444444444-444444444444444444444454554444344444444444444444444414323333233333334332333333133333333343333332332222233222123333211322221111143344444334443444444444412111111112211323233111111111-1-1--------------------1------1131122232234 12--1-2-311-3332332123243432223332231222222111221421231111222234333323333233312333333332-24332222222233132-24-21-1-1--1--1111--1-141-1121--1--11----1-1-11---111341-11-111--3213444b3334453562851344332 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 196 STR:RPRED 100.0 SQ:SECSTR HHHHHTcccEEEccccccccEEEEEEccccccHHHHHHHHHHHccEEcccHHHHHHHTTTccHHHHHTTcccccTTccEEETTcGGGGccccHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHTccHHHTHHHHHTTTHHHHHHHHHHHHHHHTTEEEEcccTTcTTcTTHHHHHHHHHHHHHHHHEcTH PSIPRED cEEEEEccccHHHHHHHHHHHcccEEEEEEcccccHHHHHHccccEEEEccccccHHHcccHHHHHHHHcccccEEEEcHHHHHHHHHcccEEEEccccEEcccEEEEEccccccccccccEEEEEEEEEEEcHHHcccccEEEEEEccccEEEEEEccccEEEEEccccccccccHHHHHHHHHHHHHHHHHccc //