[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : pduU
DDBJ      :pduU         propanediol utilization protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  103/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.56
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->116 3cgiC PDBj 6e-37 61.9 %
:RPS:PDB   3->116 3cgiC PDBj 2e-30 61.1 %
:RPS:SCOP  43->102 2a10A1  d.58.56.1 * 4e-08 21.7 %
:HMM:SCOP  43->105 2a1bA1 d.58.56.1 * 4.7e-13 34.9 %
:HMM:PFM   44->115 PF00936 * BMC 9.1e-22 36.6 71/75  
:BLT:SWISS 3->116 PDUU_SALTY 2e-36 61.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80599.1 GT:GENE pduU GT:PRODUCT propanediol utilization protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1095669..1096019 GB:FROM 1095669 GB:TO 1096019 GB:DIRECTION + GB:GENE pduU GB:PRODUCT propanediol utilization protein GB:NOTE 116 aa, similar to sp:PDUU_SALTY PROPANEDIOL UTILIZATION PROTEIN PDUU from Salmonella enterica serovar Typhimurium (116 aa); 61.4% identity in 114 aa overlap CPE0893 GB:PROTEIN_ID BAB80599.1 LENGTH 116 SQ:AASEQ MGEESKQRIIQEYVPGKQVTLAHIIANPNEDIYKKLGLIVDKKDAIGILTITPSEASIIAADVATKASGVSLGFIDRFSGSLVVTGDISSVESALNEVLDVLGNILNFSSTKITRT GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 3->116|PDUU_SALTY|2e-36|61.9|113/116| BL:PDB:NREP 1 BL:PDB:REP 3->116|3cgiC|6e-37|61.9|113/119| RP:PDB:NREP 1 RP:PDB:REP 3->116|3cgiC|2e-30|61.1|113/119| HM:PFM:NREP 1 HM:PFM:REP 44->115|PF00936|9.1e-22|36.6|71/75|BMC| RP:SCP:NREP 1 RP:SCP:REP 43->102|2a10A1|4e-08|21.7|60/104|d.58.56.1| HM:SCP:REP 43->105|2a1bA1|4.7e-13|34.9|63/0|d.58.56.1|1/1|CcmK-like| OP:NHOMO 134 OP:NHOMOORG 103 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1111111---------------------1-1----------11---------------------------------------------1----------23-11111111111-111-11-32---1----11-2------1----11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11-1--------------------------------------------------1-1--------------------------------------2------1111111121-1111121111112111112222-----2222222222222221-1111112--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 114 STR:RPRED 98.3 SQ:SECSTR ##cccccccccccccccEEEEEEEEccccHHHHHHTTcccccccEEEEEEEEcTTHHHHHHHHHHHHccEEEEEEETTTTEEEEEEcHHHHHHHHHHHHHHHHHHHccEEcccEEE DISOP:02AL 1-5, 8-9| PSIPRED cccccHHcccEEcccccEEEEEEEEEcccHHHHHHccccccccccEEEEEEcccccEEEEEEEEEccccEEEEEEEEcccEEEEEEEHHHHHHHHHHHHHHHHHHHcccccEEEEc //