[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : phnA
DDBJ      :phnA         alkylphosphonate uptake protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  461/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.34.11g.41.3g.41.9
:112 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->112 2aklA PDBj 3e-38 62.4 %
:RPS:PDB   1->112 2aklA PDBj 2e-33 70.5 %
:RPS:SCOP  7->36 1i3qL  g.41.9.2 * 1e-06 16.7 %
:RPS:SCOP  43->111 2akkA1  b.34.11.2 * 6e-32 44.9 %
:HMM:SCOP  2->39 2aklA2 g.41.3.5 * 7e-14 65.8 %
:HMM:SCOP  39->112 2aklA1 b.34.11.2 * 3.2e-30 68.9 %
:RPS:PFM   4->31 PF08274 * PhnA_Zn_Ribbon 2e-11 82.1 %
:RPS:PFM   44->98 PF03831 * PhnA 8e-19 83.6 %
:HMM:PFM   44->98 PF03831 * PhnA 1.4e-31 78.2 55/56  
:HMM:PFM   4->32 PF08274 * PhnA_Zn_Ribbon 4.7e-19 79.3 29/30  
:BLT:SWISS 4->111 PHNA_SHIFL 1e-47 75.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82298.1 GT:GENE phnA GT:PRODUCT alkylphosphonate uptake protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2970830..2971168) GB:FROM 2970830 GB:TO 2971168 GB:DIRECTION - GB:GENE phnA GB:PRODUCT alkylphosphonate uptake protein GB:NOTE 112 aa, similar to sp:PHNA_ECOLI PHNA PROTEIN from Escherichia coli (111 aa); 75.9% identity in 108 aa overlap CPE2592 GB:PROTEIN_ID BAB82298.1 LENGTH 112 SQ:AASEQ MDKLPNCPKCNSEYTYEDGSLLVCPECAYEWTPGSENADEDVLVVKDSNGNILQDGDTVTIIKDLKVKGASSALKKGTKVKNIRLVEGDHNIDCKIDGFGAMSLKSEFVKKI GT:EXON 1|1-112:0| BL:SWS:NREP 1 BL:SWS:REP 4->111|PHNA_SHIFL|1e-47|75.9|108/111| BL:PDB:NREP 1 BL:PDB:REP 4->112|2aklA|3e-38|62.4|109/116| RP:PDB:NREP 1 RP:PDB:REP 1->112|2aklA|2e-33|70.5|112/116| RP:PFM:NREP 2 RP:PFM:REP 4->31|PF08274|2e-11|82.1|28/31|PhnA_Zn_Ribbon| RP:PFM:REP 44->98|PF03831|8e-19|83.6|55/55|PhnA| HM:PFM:NREP 2 HM:PFM:REP 44->98|PF03831|1.4e-31|78.2|55/56|PhnA| HM:PFM:REP 4->32|PF08274|4.7e-19|79.3|29/30|PhnA_Zn_Ribbon| RP:SCP:NREP 2 RP:SCP:REP 7->36|1i3qL|1e-06|16.7|30/46|g.41.9.2| RP:SCP:REP 43->111|2akkA1|6e-32|44.9|69/72|b.34.11.2| HM:SCP:REP 2->39|2aklA2|7e-14|65.8|38/0|g.41.3.5|1/1|Zinc beta-ribbon| HM:SCP:REP 39->112|2aklA1|3.2e-30|68.9|74/0|b.34.11.2|1/1|Prokaryotic SH3-related domain| OP:NHOMO 475 OP:NHOMOORG 464 OP:PATTERN -------------------------------------------------------------------- ------11111---------------------1----1--------1-------1--------------------------------------------11211--11-----------------11-11-111-1----------------------------------------------------------111111121111211----1-111---1-111111111-1--------------1---11----------------------1111111111111111111111111111-111111111-11111111--1---------1-1-1--1111--------------------------11-11111-11-1--111---111111111111-111-11111111--1-2111111221-111111--11111-1111111111-1111111-------------------------------13-1-----11111111111--11111111111--1111--11----1121--11--211111111111---1111-----1--11----111111111----1---1--1-1111111-1111111-111111-1111-21111-111111111111111111-------------11111111111111-11-1111111111111111111111111111111111111111111111111111-111111111111---------1-1111--1111111111111111111111111111111111111111111111111111111-11-111111-1--1111111111------1-----------------1-------------------------------------- -------------1-----------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 100.0 SQ:SECSTR cccccccTTTcccccEEccccEEETTTTEEEcTTTTcccccccccccTTcccccTTcEEEccccEEccccccEEcTTcEEEccEEcccTTcEEEEETTTEEEEEcGGGcccc DISOP:02AL 1-2| PSIPRED ccccccccccccccEEccccEEEccccccccccccccccccccEEEcccccEEcccccEEEEEEccccccccEEEEcEEEEEEEEcccccEEEEEEcccEEEEEEEEEEEcc //