[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : proB
DDBJ      :proB         glutamate 5-kinase
Swiss-Prot:PROB_CLOPE   RecName: Full=Glutamate 5-kinase;         EC=2.7.2.11;AltName: Full=Gamma-glutamyl kinase;         Short=GK;

Homologs  Archaea  9/68 : Bacteria  722/915 : Eukaryota  179/199 : Viruses  0/175   --->[See Alignment]
c.73.1
:269 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->266 2j5tD PDBj 8e-48 39.5 %
:RPS:PDB   9->264 2akoA PDBj 4e-40 35.6 %
:RPS:SCOP  9->263 2akoA1  c.73.1.3 * 2e-37 34.5 %
:HMM:SCOP  9->266 2akoA1 c.73.1.3 * 2.8e-66 41.6 %
:RPS:PFM   10->199 PF00696 * AA_kinase 2e-12 35.4 %
:HMM:PFM   9->243 PF00696 * AA_kinase 8.6e-37 31.1 219/243  
:BLT:SWISS 1->269 PROB_CLOPE e-142 100.0 %
:PROS 202->215|PS00153|ATPASE_GAMMA
:PROS 215->232|PS00902|GLUTAMATE_5_KINASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82285.1 GT:GENE proB GT:PRODUCT glutamate 5-kinase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2954670..2955479) GB:FROM 2954670 GB:TO 2955479 GB:DIRECTION - GB:GENE proB GB:PRODUCT glutamate 5-kinase GB:NOTE 269 aa, similar to sp:PROB_STRTR GLUTAMATE 5-KINASE (EC 2.7.2.11) (GAMMA-GLUTAMYL KINASE) (GK) from Streptococcus thermophilus (267 aa); 46% identity in 263 aa overlap. 1 putative transmembrane region was found by PSORT CPE2579 GB:PROTEIN_ID BAB82285.1 LENGTH 269 SQ:AASEQ MRKALKDSKRIVVKVGTSTLTYENGSVNLMRIEKLSRVISDICNMGKEVVLVSSGAIGVGVGKLRLEKKPETIREKQAVAAVGQCALMHIYNKFFGEYSHVVAQVLLTRDVLENERMKNNVCNTFDTLLEKGIIPIVNENDAISIDEIQNILNFGDNDNLSAIVSTLVNADTLIILSDIDGFYDSDPRTNEDSKMLKEVYEITPEIEECAGGAGSNRGTGGMVTKLSAAKVATSNGIDMILANGENPEILIDILNGEDIGTMFVAKKGE GT:EXON 1|1-269:0| SW:ID PROB_CLOPE SW:DE RecName: Full=Glutamate 5-kinase; EC=2.7.2.11;AltName: Full=Gamma-glutamyl kinase; Short=GK; SW:GN Name=proB; OrderedLocusNames=CPE2579; SW:KW Amino-acid biosynthesis; ATP-binding; Complete proteome; Cytoplasm;Kinase; Nucleotide-binding; Proline biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->269|PROB_CLOPE|e-142|100.0|269/269| GO:SWS:NREP 7 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006561|"GO:proline biosynthetic process"|Proline biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 202->215|PS00153|ATPASE_GAMMA|PDOC00138| PROS 215->232|PS00902|GLUTAMATE_5_KINASE|PDOC00701| SEG 211->221|ggagsnrgtgg| BL:PDB:NREP 1 BL:PDB:REP 7->266|2j5tD|8e-48|39.5|256/365| RP:PDB:NREP 1 RP:PDB:REP 9->264|2akoA|4e-40|35.6|236/237| RP:PFM:NREP 1 RP:PFM:REP 10->199|PF00696|2e-12|35.4|178/244|AA_kinase| HM:PFM:NREP 1 HM:PFM:REP 9->243|PF00696|8.6e-37|31.1|219/243|AA_kinase| GO:PFM:NREP 1 GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF00696|IPR001048| RP:SCP:NREP 1 RP:SCP:REP 9->263|2akoA1|2e-37|34.5|238/241|c.73.1.3| HM:SCP:REP 9->266|2akoA1|2.8e-66|41.6|250/0|c.73.1.3|1/1|Carbamate kinase-like| OP:NHOMO 1018 OP:NHOMOORG 910 OP:PATTERN ---------------------------111-11----------------1111--------------- -1-1111111111111111-111111111111111111111111111-1111111111--111111111111111111--11-11111111111-------1-111-111---------------11111111111111111111-11111111111111111111111111111111111111111111111211111111-11111111222211111111--11111111--------------------1---11-1---111111-1-11111111111111111111111111111111111111-1111111111112111-------1-11-221111111--111111111111-111111--1111111111111111111111111111111111111-11111111121-1111111111121111211111111111111111111111111-----------------------------1211111111111111111111111111111111111111111111111111111111111111-111111111111-1111111111111-111111111111111111-1111111---1-------2111133111211112221222222122222111211---1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---2-----111111111111111-11111111111111111111111111111111111111--------111111111111111111111111111111111111111---------1---------------------------11--1-111111 --11--1-31--111111-1111111111111111111111111111-11111111111111111111-1221112212211111111-11111111111111311--2-22322221111111111112C2-12311-1211111111111111111211--111-1112122-1212E2221212331212133321 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 268 STR:RPRED 99.6 SQ:SECSTR #EcccccccEEEEEEcHHHHccccccccHHHHHHHHHHHHHHHHHHcEEEEEEccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHGGGTccEEEEEEcTGGGGcHHHHHHHHHHHHHHHHTTcEEEEEEcTTTccHHHHcTEEEETTHHHHHHHHHHTTccEEEEEEcccccccccTTTcTTcccccEEccccGGGcccccccccccTTcHHHHHHHHHHHHHHTTcEEEEEccccHHHHHHHHcccccccEEEccEcc DISOP:02AL 1-6, 267-269| PSIPRED cHHHHHHccEEEEEEccEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccEEEccccccccccccHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccEEcccHHHHHHHHccccccEEcccccHHHHHHHHHHHccccEEEEEccccHHHHHHHcccccEEEEEccccc //