[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : purC
DDBJ      :purC         phosphoribosylaminoimidazole-succinocarboxamide synthase
Swiss-Prot:PUR7_CLOPE   RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide synthase;         EC=6.3.2.6;AltName: Full=SAICAR synthetase;

Homologs  Archaea  48/68 : Bacteria  590/915 : Eukaryota  101/199 : Viruses  0/175   --->[See Alignment]
d.143.1
:235 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->233 2ywvA PDBj 2e-72 56.2 %
:RPS:PDB   1->137 1a48A PDBj 1e-24 23.0 %
:RPS:SCOP  14->235 1kutA  d.143.1.1 * 1e-72 39.6 %
:HMM:SCOP  2->233 2cnqA1 d.143.1.1 * 3e-83 48.5 %
:RPS:PFM   6->230 PF01259 * SAICAR_synt 6e-40 42.9 %
:HMM:PFM   5->233 PF01259 * SAICAR_synt 1.4e-73 39.6 227/249  
:BLT:SWISS 1->235 PUR7_CLOPE e-134 100.0 %
:PROS 87->101|PS01057|SAICAR_SYNTHETASE_1
:PROS 174->182|PS01058|SAICAR_SYNTHETASE_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80388.1 GT:GENE purC GT:PRODUCT phosphoribosylaminoimidazole-succinocarboxamide synthase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 849929..850636 GB:FROM 849929 GB:TO 850636 GB:DIRECTION + GB:GENE purC GB:PRODUCT phosphoribosylaminoimidazole-succinocarboxamide synthase GB:NOTE 235 aa, similar to sp:PUR7_BACSU PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE (EC 6.3.2.6) (SAICAR SYNTHETASE) (VEGETATIVE PROTEIN 286A) (VEG286A) from Bacillus subtilis (241 aa); 59.2% identity in 228 aa overlap CPE0682 GB:PROTEIN_ID BAB80388.1 LENGTH 235 SQ:AASEQ MVNQLEMLYEGKAKKIYATDKEDMVIVHYKDDATAFNGEKKAQIESKGVLNNEITSLIFEMLNKEGIKTHFVEKLNDRDQLCKKVEIVPLEVIVRNVAAGSMAKRLGLEEGYELKTTVFELSYKDDSLGDPLINDYHAVGIGATTFEELNKIYEITAKVNEILKEAFKKQNINLIDFKLEFGRYNGEILLADEISPDTCRFWDATTGEKMDKDRFRRDMGNVINGYREVLNRLRN GT:EXON 1|1-235:0| SW:ID PUR7_CLOPE SW:DE RecName: Full=Phosphoribosylaminoimidazole-succinocarboxamide synthase; EC=6.3.2.6;AltName: Full=SAICAR synthetase; SW:GN Name=purC; OrderedLocusNames=CPE0682; SW:KW ATP-binding; Complete proteome; Ligase; Nucleotide-binding;Purine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->235|PUR7_CLOPE|e-134|100.0|235/235| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| PROS 87->101|PS01057|SAICAR_SYNTHETASE_1|PDOC00810| PROS 174->182|PS01058|SAICAR_SYNTHETASE_2|PDOC00810| BL:PDB:NREP 1 BL:PDB:REP 1->233|2ywvA|2e-72|56.2|233/237| RP:PDB:NREP 1 RP:PDB:REP 1->137|1a48A|1e-24|23.0|135/298| RP:PFM:NREP 1 RP:PFM:REP 6->230|PF01259|6e-40|42.9|224/244|SAICAR_synt| HM:PFM:NREP 1 HM:PFM:REP 5->233|PF01259|1.4e-73|39.6|227/249|SAICAR_synt| GO:PFM:NREP 2 GO:PFM GO:0004639|"GO:phosphoribosylaminoimidazolesuccinocarboxamide synthase activity"|PF01259|IPR001636| GO:PFM GO:0006164|"GO:purine nucleotide biosynthetic process"|PF01259|IPR001636| RP:SCP:NREP 1 RP:SCP:REP 14->235|1kutA|1e-72|39.6|207/213|d.143.1.1| HM:SCP:REP 2->233|2cnqA1|3e-83|48.5|229/0|d.143.1.1|1/1|SAICAR synthase-like| OP:NHOMO 792 OP:NHOMOORG 739 OP:PATTERN --11--1111111111-111111---------111112111111-111-1121111122-1-11--11 -11-1-11--1111------------------------------1-------1111----1-11----1--1111111-111111111-----------1-------------------------1111111111111111---11111111111111111111111111111111111111111111--11111111111111111111111111111112111111111111111111111111111111111-11111-1-11111111111111111111111111111111111111111111111-111111111111111111111111111211111111111-1-112211111111112111111-111111111111221111122111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---------------------------------11---------------------1---11111--------1111112-1111-11-1-1--1------21-1111111111-1-------1111111---11--1----------------------1-11---------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--1-11111-111-1111--------1-1-11-1111111111-111111111-1111-111----------------------------------------11111111------------------------------------1-11111111--1 ----111------11-1--------------------1-11-1-------1111--------11-11111111-1111111---1-1--12-11-1-------11-----2111111111-1114212-283-2231-111-1711111111-2-1212125111-121111111--------------1----11-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 235 STR:RPRED 100.0 SQ:SECSTR cTTcccEEEEcccEEEEEEETTTEEEEEEccccEETTEEcccccTTHHHHHHHHHHHHHHHTTGGGGcHHHHHHHTTcEEEEEccEEccccEEEEEEccHHHHHHHHEHHcEETTEEccccccTTcEEEEEEEccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHTEEEEEEEEEEEETTTEEEEEccccTTTEEEEETcccccccTHHHHHHHHHTTcTTcTTccccHH DISOP:02AL 1-5| PSIPRED cccccccEEEccEEEEEEcccccEEEEEEEcccEEEcEEEcccccHHHHHHHHHHHHHHHHHHHccccEEEcccccccEEEEEEcEEEEEEEEEEcEEEccHHHHccccccccccccEEEEEEcccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEcccEEEEEEEcccccccccccccccccHHHHHHHHHHccHHHHHHHHHHcc //