[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : purE
DDBJ      :purE         phosphoribosylaminoimidazole carboxylase catalytic subunit
Swiss-Prot:             

Homologs  Archaea  59/68 : Bacteria  820/915 : Eukaryota  119/199 : Viruses  0/175   --->[See Alignment]
c.23.8
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->150 1o4vA PDBj 2e-31 47.7 %
:RPS:PDB   3->153 1d7aA PDBj 2e-33 40.5 %
:RPS:SCOP  1->155 1d7aA  c.23.8.1 * 1e-37 40.6 %
:HMM:SCOP  1->160 1o4vA_ c.23.8.1 * 1.2e-53 52.5 %
:RPS:PFM   3->142 PF00731 * AIRC 2e-28 52.9 %
:HMM:PFM   2->148 PF00731 * AIRC 1.9e-62 55.1 147/150  
:BLT:SWISS 3->155 PUR6_AQUAE 3e-36 51.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80387.1 GT:GENE purE GT:PRODUCT phosphoribosylaminoimidazole carboxylase catalytic subunit GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 849450..849929 GB:FROM 849450 GB:TO 849929 GB:DIRECTION + GB:GENE purE GB:PRODUCT phosphoribosylaminoimidazole carboxylase catalytic subunit GB:NOTE 159 aa, similar to sp:PUR6_PYRHO PHOSPHORIBOSYLAMINOIMIDAZOLE CARBOXYLASE CATALYTIC SUBUNIT (EC 4.1.1.21) (AIR CARBOXYLASE) (AIRC) from Pyrococcus horikoshii (177 aa); 56.8% identity in 146 aa overlap. 1 putative transmembrane region was found by PSORT CPE0681 GB:PROTEIN_ID BAB80387.1 LENGTH 159 SQ:AASEQ MKVAIFFGSKSDIDVMKGAGNALKEFGIPYNAYILSAHRVPEKLIETLEKIEKEGCEVIIAGAGLAAHLPGVIASHTILPVIGVPVRAAVEGMDALLSIVQMPKSIPVATVGINNSYNAGMLAVQMLSLKYPELREKLIQFRIDMKHKFIAENGEGVEL GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 3->155|PUR6_AQUAE|3e-36|51.0|153/167| SEG 42->54|eklietlekieke| BL:PDB:NREP 1 BL:PDB:REP 2->150|1o4vA|2e-31|47.7|149/169| RP:PDB:NREP 1 RP:PDB:REP 3->153|1d7aA|2e-33|40.5|148/157| RP:PFM:NREP 1 RP:PFM:REP 3->142|PF00731|2e-28|52.9|140/148|AIRC| HM:PFM:NREP 1 HM:PFM:REP 2->148|PF00731|1.9e-62|55.1|147/150|AIRC| GO:PFM:NREP 2 GO:PFM GO:0004638|"GO:phosphoribosylaminoimidazole carboxylase activity"|PF00731|IPR000031| GO:PFM GO:0006189|"GO:'de novo' IMP biosynthetic process"|PF00731|IPR000031| RP:SCP:NREP 1 RP:SCP:REP 1->155|1d7aA|1e-37|40.6|155/161|c.23.8.1| HM:SCP:REP 1->160|1o4vA_|1.2e-53|52.5|160/0|c.23.8.1|1/1|N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE)| OP:NHOMO 1025 OP:NHOMOORG 998 OP:PATTERN --11--1111111111-111111-11111111111111111111111111112111111-1111--11 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---11111111111---------------1111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111-11111-1-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------111111111111-111111111111111111111111111111111111111111-11111111111111111111111111111112111111111111121211111111111111111111-1-------11111112221111111211111111111121111111-11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------------------------------1-11111111111 ----111-----111111111111111111111111111111111-111111111111111111111111111111111111111111-1111111111111111--12-------------------------------------------------------------------11181111111121221111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 100.0 SQ:SECSTR EEcEEEEccGGGHHHHHHHHHHHHHHTccEEEEEccTTTcHHHHHHHHHTTTTTTccEEEEEEcccccHHHHHHHcccccEEEEEccTTTTTHHHHHHHHcccTTcccEEccccHHHHHHHHHHHHHGGGcHHHHHHHHHHHHHHHHHHHTccccHHTT DISOP:02AL 145-157| PSIPRED cEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEEccHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHccccEEEcccccccHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccc //