[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : pyrC
DDBJ      :pyrC         dihydroorotase
Swiss-Prot:             

Homologs  Archaea  66/68 : Bacteria  710/915 : Eukaryota  126/199 : Viruses  0/175   --->[See Alignment]
b.92.1c.1.9
:399 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->395 3d6nA PDBj 2e-77 42.0 %
:RPS:PDB   3->399 3dc8B PDBj 1e-58 23.0 %
:RPS:SCOP  3->80 1ymyA1  b.92.1.5 * 8e-15 14.1 %
:RPS:SCOP  53->340 1gkrA2  c.1.9.6 * 8e-73 26.6 %
:RPS:SCOP  327->396 2icsA1  b.92.1.8 * 1e-12 25.0 %
:HMM:SCOP  1->91 1onwA1 b.92.1.7 * 1.9e-15 28.6 %
:HMM:SCOP  52->343 1ynyA2 c.1.9.6 * 9.3e-83 38.5 %
:HMM:SCOP  342->398 2fvkA1 b.92.1.3 * 2.6e-16 43.9 %
:RPS:PFM   48->354 PF01979 * Amidohydro_1 3e-15 30.3 %
:HMM:PFM   48->354 PF01979 * Amidohydro_1 8.5e-26 20.6 281/328  
:BLT:SWISS 1->395 PYRC_CLOBA e-145 61.5 %
:PROS 280->291|PS00483|DIHYDROOROTASE_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80887.1 GT:GENE pyrC GT:PRODUCT dihydroorotase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1376997..1378196) GB:FROM 1376997 GB:TO 1378196 GB:DIRECTION - GB:GENE pyrC GB:PRODUCT dihydroorotase GB:NOTE 399 aa, similar to sp:PYRC_AQUAE DIHYDROOROTASE (EC 3.5.2.3) (DHOASE) from Aquifex aeolicus (422 aa); 41.8% identity in 395 aa overlap CPE1181 GB:PROTEIN_ID BAB80887.1 LENGTH 399 SQ:AASEQ MNLLIKNVNLIDESNNFFGDIYIEKGVIKELGTELNKECETLDGKGLVLMPAFIDTHAHFRDPGFEYKEDIESGSKAAVRGGYTTVTLMPNTKPVCSSKEILDYVVNKGKEVGLVDLYQTVSITKNLSGEEINHLREFEGNPNVKAITDDGKGVSDSKIMMEAMKIAKENNWIVMSHAESPEFSRVDMRLAENMMTWRDITLAKFVDCRLHMSHVSTKEAMKYIIEGKNDGVKVTCEITPHHLALNNKISNYRVNPPIREEEDVNFLIKAIKMNYVDCIGTDHAPHSKEDKEKGAPGMIGIEQAFSICYTKLVKENHISLNKLSQLMSGNAAKLLNINKGKLQPGFLGDLVLIDLNKKRIFKEEDIVSRSKNTPFNGMEFYGDVVVTIKNGKIVYNGEF GT:EXON 1|1-399:0| BL:SWS:NREP 1 BL:SWS:REP 1->395|PYRC_CLOBA|e-145|61.5|395/398| PROS 280->291|PS00483|DIHYDROOROTASE_2|PDOC00401| BL:PDB:NREP 1 BL:PDB:REP 1->395|3d6nA|2e-77|42.0|393/422| RP:PDB:NREP 1 RP:PDB:REP 3->399|3dc8B|1e-58|23.0|396/474| RP:PFM:NREP 1 RP:PFM:REP 48->354|PF01979|3e-15|30.3|264/271|Amidohydro_1| HM:PFM:NREP 1 HM:PFM:REP 48->354|PF01979|8.5e-26|20.6|281/328|Amidohydro_1| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01979|IPR006680| RP:SCP:NREP 3 RP:SCP:REP 3->80|1ymyA1|8e-15|14.1|78/85|b.92.1.5| RP:SCP:REP 53->340|1gkrA2|8e-73|26.6|286/325|c.1.9.6| RP:SCP:REP 327->396|2icsA1|1e-12|25.0|64/101|b.92.1.8| HM:SCP:REP 1->91|1onwA1|1.9e-15|28.6|91/106|b.92.1.7|1/2|Composite domain of metallo-dependent hydrolases| HM:SCP:REP 52->343|1ynyA2|9.3e-83|38.5|291/0|c.1.9.6|1/1|Metallo-dependent hydrolases| HM:SCP:REP 342->398|2fvkA1|2.6e-16|43.9|57/0|b.92.1.3|1/1|Composite domain of metallo-dependent hydrolases| OP:NHOMO 1611 OP:NHOMOORG 902 OP:PATTERN 1121211111111113111111-121112131111111111111111111111111111111111-11 1131111111111111111-1211131111111111111212111121111122311111111141333312111111111151111111111111---12222242212---------------11111111111111211111112222211111------11222332--1---------122111111121111111111111113222121111212111111111231111111111111112111131-111111111111111111111111111111111111111111111111111111111111111111112213222222222213221111231311211175121111221111111112222222222224542222222222332333333-22322423232132232215422242-22143333322133333333244222121111111111---------------1111211212311--2442421111122231111113232233--221111111131421121121------1--11111111111111111111111111111111111312-1111-1111111111111111-1-22211-112-----------1--------------1111------1---1--2222222222-122222222212222222---2-----1-111-1111111111-1-----------------------1111111111123-1---------------111-1121111-333333332132211111111111112-111-----1----11111111111111-112111111--------1--------------------2------1122111111311 ----43--211----2-1-1---1211--------1----1--------------1------121-2112-11111111121111111-1-2-111-1-12--1---32268I9BA33232374FB3949V6-64C1532E5674154-3711C4A5663-733231534D4452-12-H--11231231-1--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 399 STR:RPRED 100.0 SQ:SECSTR cEEEEEccEEEccccEEEcEEEEETTEEEEEEcccccccEEEEcTTcEEEEcEEEEEEcTTcEETEccccHHHHHHHHHHTTEEEEEEEEccccccHHHHHHHHHHHTTTcccEEEEEEEEccccHHHHHHHHHHHHHccccEEEEcccTTTTcccHHHHHHHHHHHHHHTcEEEEEcccHHHHHHccHHHHHHHHHHHHHHHHHHTccEEEcccccHHHHHHHHHHHHTTccEEEcccHHHHHccGGGHHTccccccccGGGHHHHHHHHHHTcccccccccccccHHHHGGGTTcGGcTTTHHHHHHHHHTTTTcccHHHHHHHHTHHHHHHTTcTcccccTTccccEEEEEEEEEEEccGGGccccccccTTTTcEEEEEEEEEEETTEEEETTEE DISOP:02AL 399-400| PSIPRED ccEEEEccEEEcccccEEEEEEEEccEEEEEEcccccccEEEEccccEEEEEEEccEEEccccccccHHHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHcccccEEEEccccccccccHHHHHHHHHHccccccEEEcccccccccHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHcccEEEEEccHHHHHccccccccccccccccHHHHHHHHHHHHcccEEEEEcccccccHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccEEEccccccEEEEcccccEEEcHHHHHHcccccccccEEEEEEEEEEEEccEEEEcccc //