[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : pyrZ
DDBJ      :pyrZ         dihydroorotate dehydrogenase electron transfer subunit
Swiss-Prot:PYRK_CLOPE   RecName: Full=Dihydroorotate dehydrogenase electron transfer subunit;

Homologs  Archaea  40/68 : Bacteria  251/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.43.4c.25.1
:246 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->244 1ep1B PDBj 2e-22 31.6 %
:RPS:PDB   6->215 2bgjA PDBj 3e-23 16.7 %
:RPS:SCOP  2->93 1ep1B1  b.43.4.2 * 1e-10 27.2 %
:RPS:SCOP  88->246 1ep1B2  c.25.1.3 * 1e-24 32.5 %
:HMM:SCOP  2->93 1ep3B1 b.43.4.2 * 1.3e-16 28.3 %
:HMM:SCOP  88->246 1ep3B2 c.25.1.3 * 2.5e-38 36.4 %
:RPS:PFM   104->192 PF00175 * NAD_binding_1 3e-06 36.0 %
:RPS:PFM   208->244 PF10418 * DHODB_Fe-S_bind 2e-08 59.5 %
:HMM:PFM   208->244 PF10418 * DHODB_Fe-S_bind 1.7e-17 64.9 37/40  
:HMM:PFM   104->193 PF00175 * NAD_binding_1 8.4e-17 35.6 90/109  
:HMM:PFM   24->91 PF00970 * FAD_binding_6 0.00033 22.1 68/99  
:BLT:SWISS 1->246 PYRK_CLOPE e-145 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80885.1 GT:GENE pyrZ GT:PRODUCT dihydroorotate dehydrogenase electron transfer subunit GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1375359..1376099) GB:FROM 1375359 GB:TO 1376099 GB:DIRECTION - GB:GENE pyrZ GB:PRODUCT dihydroorotate dehydrogenase electron transfer subunit GB:NOTE 246 aa, similar to sp:PYRZ_BACSU DIHYDROOROTATE DEHYDROGENASE ELECTRON TRANSFER SUBUNIT from Bacillus subtilis (256 aa); 37% identity in 235 aa overlap CPE1179 GB:PROTEIN_ID BAB80885.1 LENGTH 246 SQ:AASEQ MAMEYFKGKVKENIELVEGIYSLVVEHEAKINAGQFYMIKTPNTFLGRPISVCEVNGNDVRFVYATVGAGTNEMKKMISGDEIEIIGPLGNGFDINKDYGRVALVSGGIGTAPMLELAKSLRKNNKDIKMDFYGGFRDDIYLVDEIAEYVDEVKISTNTGKHGHKGFVTEILPLQEYDTVLCCGPEIMMKKVVEMCKEAKVNVYISMEKHMACGVGACLVCICKTKSGNKRTCKDGPVFNGLEVEF GT:EXON 1|1-246:0| SW:ID PYRK_CLOPE SW:DE RecName: Full=Dihydroorotate dehydrogenase electron transfer subunit; SW:GN Name=pyrK; Synonyms=pyrZ; OrderedLocusNames=CPE1179; SW:KW 2Fe-2S; Complete proteome; Electron transport; FAD; Flavoprotein;Iron; Iron-sulfur; Metal-binding; Pyrimidine biosynthesis; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->246|PYRK_CLOPE|e-145|100.0|246/246| GO:SWS:NREP 6 GO:SWS GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|2Fe-2S| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006221|"GO:pyrimidine nucleotide biosynthetic process"|Pyrimidine biosynthesis| GO:SWS GO:0006810|"GO:transport"|Transport| BL:PDB:NREP 1 BL:PDB:REP 34->244|1ep1B|2e-22|31.6|209/261| RP:PDB:NREP 1 RP:PDB:REP 6->215|2bgjA|3e-23|16.7|209/260| RP:PFM:NREP 2 RP:PFM:REP 104->192|PF00175|3e-06|36.0|89/107|NAD_binding_1| RP:PFM:REP 208->244|PF10418|2e-08|59.5|37/38|DHODB_Fe-S_bind| HM:PFM:NREP 3 HM:PFM:REP 208->244|PF10418|1.7e-17|64.9|37/40|DHODB_Fe-S_bind| HM:PFM:REP 104->193|PF00175|8.4e-17|35.6|90/109|NAD_binding_1| HM:PFM:REP 24->91|PF00970|0.00033|22.1|68/99|FAD_binding_6| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00175|IPR001433| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00175|IPR001433| RP:SCP:NREP 2 RP:SCP:REP 2->93|1ep1B1|1e-10|27.2|92/101|b.43.4.2| RP:SCP:REP 88->246|1ep1B2|1e-24|32.5|154/160|c.25.1.3| HM:SCP:REP 2->93|1ep3B1|1.3e-16|28.3|92/0|b.43.4.2|1/1|Riboflavin synthase domain-like| HM:SCP:REP 88->246|1ep3B2|2.5e-38|36.4|154/0|c.25.1.3|1/1|Ferredoxin reductase-like, C-terminal NADP-linked domain| OP:NHOMO 516 OP:NHOMOORG 291 OP:PATTERN --21------------1------1-----1--111111111111222232222145333431223-11 -1----------------------1--------111---12----------------------1------111111112121-2122122223222-----------------------------33333233423-----222-----1--------------------------------------222-111111111111111111111111111111111111111--1--------------1----2----------------1-----111-------11111111111111-------------111111111-21125444444454623223443242211223322543222333431211-21---------1-------22112--------------1-------------------------------------------------------------------------------------------------------------------------------------1-----1-------------------312243512311313232234321111--32---------------------------1-----------------------------------1---------------------------------------------------1-11111111111111-------------------------------1111------------------------------------------1------1-------------------------------------1122--------------11-------------------1------32222222221-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 244 STR:RPRED 99.2 SQ:SECSTR cTccHTEEEEEEEEEEETTEEEEEEETTccccTTcEEEEEEEcTETccEEEEEEEccccEEEEEccTTcTTHHHTTccTTcEEEEEEEEEccccGcccccEEEEEEEGGGGHHHHHHTTcHHHHHHccEEEEEEEEcTTTHHHHHHHHHHHHcHHHHHHTcccccccHHHHHccTTTEEEEEEEcHHHHHHHHHHHHHTcccccEEEEEccccccccccTTEEEcccTTcETTTTccEEETTTT## DISOP:02AL 246-247| PSIPRED cccEEEEEEEEEEEEccccEEEEEEcccccccccEEEEEEEccccEEEEEEEEcccccEEEEEEEEcccHHHHHHHcccccEEEEEccccccEEcccccccEEEEEccccHHHHHHHHHHHHHccccEEEEEEEccHHHHHcHHHHHHHHccEEEEEcccccccccHHHHHHccccccEEEEEccHHHHHHHHHHHHHccccEEEEcccccccccccccEEEEEEcccEEEEcccccEEEHHHccc //