[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : rpsF
DDBJ      :rpsF         30S ribosomal protein S6
Swiss-Prot:RS6_CLOPS    RecName: Full=30S ribosomal protein S6;

Homologs  Archaea  0/68 : Bacteria  772/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.58.14
:96 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->93 1vs5F PDBj 9e-16 35.2 %
:RPS:PDB   2->95 2bxjA PDBj 9e-29 30.9 %
:RPS:SCOP  2->95 1cqmA  d.58.14.1 * 1e-28 31.9 %
:HMM:SCOP  2->96 1cqmA_ d.58.14.1 * 5.9e-32 47.4 %
:RPS:PFM   5->93 PF01250 * Ribosomal_S6 2e-21 44.9 %
:HMM:PFM   3->93 PF01250 * Ribosomal_S6 1.7e-36 53.8 91/92  
:BLT:SWISS 2->96 RS6_CLOPS 3e-52 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82348.1 GT:GENE rpsF GT:PRODUCT 30S ribosomal protein S6 GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(3016038..3016328) GB:FROM 3016038 GB:TO 3016328 GB:DIRECTION - GB:GENE rpsF GB:PRODUCT 30S ribosomal protein S6 GB:NOTE 96 aa, similar to sp:RS6_BACSU 30S RIBOSOMAL PROTEIN S6 (BS9) from Bacillus subtilis (95 aa); 43.2% identity in 95 aa overlap CPE2642 GB:PROTEIN_ID BAB82348.1 LENGTH 96 SQ:AASEQ MMRKYETIFVAHPSLDEEAVKALIEKFKGVIENGNGTVDNVDFWGKRKLAYEIAKVNEGYYTLINFTANPELPKELDRVFGITDGIIRHIIVKEEQ GT:EXON 1|1-96:0| SW:ID RS6_CLOPS SW:DE RecName: Full=30S ribosomal protein S6; SW:GN Name=rpsF; OrderedLocusNames=CPR_2656; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 2->96|RS6_CLOPS|3e-52|100.0|95/95| GO:SWS:NREP 4 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| BL:PDB:NREP 1 BL:PDB:REP 2->93|1vs5F|9e-16|35.2|91/100| RP:PDB:NREP 1 RP:PDB:REP 2->95|2bxjA|9e-29|30.9|94/98| RP:PFM:NREP 1 RP:PFM:REP 5->93|PF01250|2e-21|44.9|89/92|Ribosomal_S6| HM:PFM:NREP 1 HM:PFM:REP 3->93|PF01250|1.7e-36|53.8|91/92|Ribosomal_S6| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01250|IPR000529| GO:PFM GO:0005840|"GO:ribosome"|PF01250|IPR000529| GO:PFM GO:0006412|"GO:translation"|PF01250|IPR000529| GO:PFM GO:0019843|"GO:rRNA binding"|PF01250|IPR000529| RP:SCP:NREP 1 RP:SCP:REP 2->95|1cqmA|1e-28|31.9|94/98|d.58.14.1| HM:SCP:REP 2->96|1cqmA_|5.9e-32|47.4|95/0|d.58.14.1|1/1|Ribosomal protein S6| OP:NHOMO 777 OP:NHOMOORG 775 OP:PATTERN -------------------------------------------------------------------- 1111111----11111111-11111111111111111111111111111111111111--111111111111111111111111-11111111111---11-1-1-1111111111111------11-------1-1-1--111111111111--1111111111111111111111111111-----11-111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111-11111111111111111-111--11111111111-----1-----11111111111-11111111111-12-111111111111111111111-111111111111111111------------1-11111111111-----1---1111111111111111111111111111111111111111111111111111111111111111111111111111-111111111-1111-1111----1-11111111111111111111111111-111111111111111111111111111111111-1111111-1111111111111111-111-1111111111111111111111111111111111111111111111111111-111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------------1---1---------------------1111--11-1--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 99.0 SQ:SECSTR #cEEEEEEEEEcTTccHHHHHHHHHHHHHHHHTTTcEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEcHHHHHHHHHHHHTcTTEEEEEEEEccG DISOP:02AL 95-96| PSIPRED ccccccEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEccccccccccHHcccccEEEEEEEEEccHHHHHHHHHHHccccccEEEEEEEEcc //