[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : rpsL
DDBJ      :rpsL         30S ribosomal protein S12
Swiss-Prot:RS12_CLOPS   RecName: Full=30S ribosomal protein S12;

Homologs  Archaea  5/68 : Bacteria  904/915 : Eukaryota  157/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->123 3bbnL PDBj 3e-47 66.7 %
:RPS:PDB   1->123 3bbnL PDBj 3e-45 66.7 %
:RPS:SCOP  2->125 1fjgL  b.40.4.5 * 4e-46 70.2 %
:HMM:SCOP  2->126 1fjgL_ b.40.4.5 * 1e-52 67.2 %
:RPS:PFM   3->123 PF00164 * Ribosomal_S12 2e-39 76.0 %
:HMM:PFM   2->123 PF00164 * Ribosomal_S12 7.4e-58 65.6 122/122  
:BLT:SWISS 1->126 RS12_CLOPS 6e-62 100.0 %
:PROS 43->50|PS00055|RIBOSOMAL_S12
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82116.1 GT:GENE rpsL GT:PRODUCT 30S ribosomal protein S12 GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2757362..2757742) GB:FROM 2757362 GB:TO 2757742 GB:DIRECTION - GB:GENE rpsL GB:PRODUCT 30S ribosomal protein S12 GB:NOTE 126 aa, similar to pir:B70148 ribosomal protein S12 from Borrelia burgdorferi (124 aa); 70.7% identity in 123 aa overlap CPE2410 GB:PROTEIN_ID BAB82116.1 LENGTH 126 SQ:AASEQ MPTISQLVRKGRKTVASKSTAPALKECPQKRGVCTVVKTTTPKKPNSALRKIARVRLTNGYEVTAYIPGVGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDSAGVANRMQGRSKYGAKKPKQKK GT:EXON 1|1-126:0| SW:ID RS12_CLOPS SW:DE RecName: Full=30S ribosomal protein S12; SW:GN Name=rpsL; OrderedLocusNames=CPR_2405; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein; RNA-binding;rRNA-binding; tRNA-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->126|RS12_CLOPS|6e-62|100.0|126/126| GO:SWS:NREP 5 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| GO:SWS GO:0000049|"GO:tRNA binding"|tRNA-binding| PROS 43->50|PS00055|RIBOSOMAL_S12|PDOC00054| SEG 35->45|tvvktttpkkp| BL:PDB:NREP 1 BL:PDB:REP 1->123|3bbnL|3e-47|66.7|123/123| RP:PDB:NREP 1 RP:PDB:REP 1->123|3bbnL|3e-45|66.7|123/123| RP:PFM:NREP 1 RP:PFM:REP 3->123|PF00164|2e-39|76.0|121/122|Ribosomal_S12| HM:PFM:NREP 1 HM:PFM:REP 2->123|PF00164|7.4e-58|65.6|122/122|Ribosomal_S12| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00164|IPR006032| GO:PFM GO:0005622|"GO:intracellular"|PF00164|IPR006032| GO:PFM GO:0005840|"GO:ribosome"|PF00164|IPR006032| GO:PFM GO:0006412|"GO:translation"|PF00164|IPR006032| RP:SCP:NREP 1 RP:SCP:REP 2->125|1fjgL|4e-46|70.2|124/125|b.40.4.5| HM:SCP:REP 2->126|1fjgL_|1e-52|67.2|125/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 1094 OP:NHOMOORG 1066 OP:PATTERN --------------------------------------------------------11111------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111112-11111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111211111111111111111111111111111111111111111111111111111111111111111111111--111111111111111-11-111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11------1---11111111111111111----11111-111111111111111111111-111111111111111111111111121-11111111111111111-1--21211--1111-1111121323-111111111111-11-1111111111211111111-111121211--------3-8112------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 124 STR:RPRED 98.4 SQ:SECSTR cccTTHHHHTcccccccccccccTTTcccEEEEEEEEEEEcccccccccEEEEEEEETTccEEEEEcccccccccTTcEEEEccccccccTTccEEccTTcTTccccTTcccccccTTcccccc## DISOP:02AL 9-22, 109-126| PSIPRED cccHHHHHHccccccccccccccccccccccEEEEEEEEEEccccccccccEEEEEEccccEEEEEEcccccccccccEEEEcccccccccccEEEEEEEEEEccccccccccccccccccccccc //