[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : rpsN
DDBJ      :rpsN         30S ribosomal protein S14
Swiss-Prot:RS14Z_CLOPS  RecName: Full=30S ribosomal protein S14 type Z;

Homologs  Archaea  0/68 : Bacteria  551/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.39.1
:61 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->61 2j00N PDBj 7e-22 68.3 %
:RPS:PDB   3->61 3bbnN PDBj 1e-14 28.8 %
:RPS:SCOP  2->61 1fjgN  g.39.1.7 * 1e-20 68.3 %
:HMM:SCOP  2->61 1fjgN_ g.39.1.7 * 5.8e-20 45.0 %
:RPS:PFM   18->60 PF00253 * Ribosomal_S14 2e-11 69.8 %
:HMM:PFM   10->60 PF00253 * Ribosomal_S14 1.8e-26 58.8 51/55  
:BLT:SWISS 1->61 RS14Z_CLOPS 4e-35 100.0 %
:PROS 23->45|PS00527|RIBOSOMAL_S14
:REPEAT 2|14->29|30->45

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82098.1 GT:GENE rpsN GT:PRODUCT 30S ribosomal protein S14 GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2745927..2746112) GB:FROM 2745927 GB:TO 2746112 GB:DIRECTION - GB:GENE rpsN GB:PRODUCT 30S ribosomal protein S14 GB:NOTE 61 aa, similar to sp:RS14_BACST 30S RIBOSOMAL PROTEIN S14 from Bacillus stearothermophilus (61 aa); 70.5% identity in 61 aa overlap CPE2392 GB:PROTEIN_ID BAB82098.1 LENGTH 61 SQ:AASEQ MARKAMIEKWKKEPKYKTRAYTRCRLCGRPHSVLKKFGICRICFRELAYKGEIPGCRKASW GT:EXON 1|1-61:0| SW:ID RS14Z_CLOPS SW:DE RecName: Full=30S ribosomal protein S14 type Z; SW:GN Name=rpsZ; Synonyms=rpsN; OrderedLocusNames=CPR_2386; SW:KW Complete proteome; Metal-binding; Ribonucleoprotein;Ribosomal protein; RNA-binding; rRNA-binding; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->61|RS14Z_CLOPS|4e-35|100.0|61/61| GO:SWS:NREP 5 GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0019843|"GO:rRNA binding"|rRNA-binding| PROS 23->45|PS00527|RIBOSOMAL_S14|PDOC00456| NREPEAT 1 REPEAT 2|14->29|30->45| BL:PDB:NREP 1 BL:PDB:REP 2->61|2j00N|7e-22|68.3|60/60| RP:PDB:NREP 1 RP:PDB:REP 3->61|3bbnN|1e-14|28.8|59/99| RP:PFM:NREP 1 RP:PFM:REP 18->60|PF00253|2e-11|69.8|43/55|Ribosomal_S14| HM:PFM:NREP 1 HM:PFM:REP 10->60|PF00253|1.8e-26|58.8|51/55|Ribosomal_S14| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00253|IPR001209| GO:PFM GO:0005622|"GO:intracellular"|PF00253|IPR001209| GO:PFM GO:0005840|"GO:ribosome"|PF00253|IPR001209| GO:PFM GO:0006412|"GO:translation"|PF00253|IPR001209| RP:SCP:NREP 1 RP:SCP:REP 2->61|1fjgN|1e-20|68.3|60/60|g.39.1.7| HM:SCP:REP 2->61|1fjgN_|5.8e-20|45.0|60/60|g.39.1.7|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 615 OP:NHOMOORG 551 OP:PATTERN -------------------------------------------------------------------- 11111---------11111-11111111111111111111111111111-----------1111111111111111111111111111--1---------1111111-1111111111111111------1-1--1-11111111---------------------1----------------11111111112111111111111111213322111111111122222211122222222222221222221-213212-21112232-1211-11122212221111111111111122222222212221--1111111111111111111111111111111-11111-111111-1111111111---11----------------------------------------------------------------------------------------1-------------------------1-11-----------------------------------1111--111------------------------------11--1111-11111111-1111111111111111111111111111--111111-1-111111111-11111-1111111-1111-1--1----1----111111111111-1111111111-1111111111111111111111111111111111111111111-11111111-1111111111111--1111111111-11-1111111-11-11111-----------1----1------------1111111111111------11111----------------1-1-121111111111111----1-111-1111111-1111111111111111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 98.4 SQ:SECSTR #ccccHHHHccccccccGGcccccccccccccccTTTcccTTHHHHHHTTTcccccccccc DISOP:02AL 1-2, 8-10, 14-17| PSIPRED ccHHHHHHHHHHccccccEEEEcEEccccccEEEccccccHHHHHHHHHcccccccEEccc //