[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : sdhA.2
DDBJ      :sdhA         probable L-serine dehydratase alpha subunit
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  585/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
e.44.1
:293 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  19->282 1szqA  e.44.1.1 * 1e-24 9.8 %
:RPS:PFM   88->277 PF03313 * SDH_alpha 3e-30 39.7 %
:HMM:PFM   15->277 PF03313 * SDH_alpha 3.1e-78 41.9 258/283  
:BLT:SWISS 4->290 SDHA_BACSU 3e-61 43.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82330.1 GT:GENE sdhA.2 GT:PRODUCT probable L-serine dehydratase alpha subunit GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 2999253..3000134 GB:FROM 2999253 GB:TO 3000134 GB:DIRECTION + GB:GENE sdhA GB:PRODUCT probable L-serine dehydratase alpha subunit GB:NOTE 293 aa, similar to sp:SDHA_BACSU PROBABLE L-SERINE DEHYDRATASE, ALPHA CHAIN (EC 4.2.1.13) (L-SERINE DEAMINASE) (SDH) (L-SD) from Bacillus subtilis (300 aa); 42.2% identity in 287 aa overlap. 3 putative transmembrane regions were found by PSORT. CPE2624 GB:PROTEIN_ID BAB82330.1 LENGTH 293 SQ:AASEQ MIARSGAELLEICRENNFSLAEYAIQYEMESKNCTREDVIKGMEKVLQVMKEAANEGQEKEVYSVSGLIGGDAYKLKKYLEKGDTLTGNVMVGAMARALSCSEVNASMGRIVACPTAGSCGILPAVILTVGERLNLSDEELIQGLLASSAVGMIIAQNATLAGAEGGCQAECGSAAAMGAAATVEMMGGTPEMALDAGAIVFKNILGLVCDPIAGLVEVPCAKRNFAGAVSALTTADLVMAGIHSKIPFDDTVEAMYRVGKSLPASLRETALGGLAITKTGLKLKEKVFGKDK GT:EXON 1|1-293:0| BL:SWS:NREP 1 BL:SWS:REP 4->290|SDHA_BACSU|3e-61|43.4|286/300| SEG 162->189|agaeggcqaecgsaaamgaaatvemmgg| RP:PFM:NREP 1 RP:PFM:REP 88->277|PF03313|3e-30|39.7|189/275|SDH_alpha| HM:PFM:NREP 1 HM:PFM:REP 15->277|PF03313|3.1e-78|41.9|258/283|SDH_alpha| RP:SCP:NREP 1 RP:SCP:REP 19->282|1szqA|1e-24|9.8|244/473|e.44.1.1| OP:NHOMO 859 OP:NHOMOORG 614 OP:PATTERN ----------------------------------------------------------------1--- 111-112-11111----11-111111111111-----1341---1-11-11-333111--11-1112111-11111111111------1111-111---1111111-1-1--------------1-----------------------------------------1----------------11111--1-1122222111121221111111112211111111111111-1111111111111112111121--11---1111111111----11111111111--1111111111111111111111111111111111-11121111111111-111122221-11-1---11-1--1121111--1-1-22111-1111-1------------111-111111-11-1121-21--111111111111211111111111111--------11111-----------------------------------211111112222222111122222222122331211--11311111--11-1-11----211111-1111--------1112112111--------------11-------1111111-1111111-------2211--111112111112211112122122--1----------32222213333332333-3333333333333333332222221124333444444444434233333331-211111111111---1111111111--111111-111111----111111--1111-22223333133341111111111111-222222222322231111111111-------1--------------1---------------------------1-111-1-----1 -----------2111-1-------------------------------11111111---------------------------------1111111----111222--2------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 291-293| PSIPRED cccccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccEEccccccEEEcHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHccHHHHHHHHHHHcccc //