[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : sipS.1
DDBJ      :sipS         type I signal peptidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  347/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
b.87.1
:169 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   32->87,106->160 1t7dB PDBj 3e-07 41.1 %
:RPS:PDB   43->167 1b12A PDBj 6e-16 18.9 %
:RPS:SCOP  25->138 1b12A  b.87.1.2 * 3e-12 24.1 %
:HMM:SCOP  23->168 1b12A_ b.87.1.2 * 3.2e-39 41.7 %
:RPS:PFM   31->97 PF00717 * Peptidase_S24 8e-08 41.8 %
:RPS:PFM   75->160 PF10502 * Peptidase_S26 1e-13 49.4 %
:HMM:PFM   32->99 PF00717 * Peptidase_S24 7.3e-19 41.5 65/70  
:HMM:PFM   74->142 PF10502 * Peptidase_S26 8.6e-08 25.0 68/138  
:HMM:PFM   5->31 PF06143 * Baculo_11_kDa 7.7e-05 25.9 27/84  
:BLT:SWISS 1->167 LEP_STAAR 3e-28 40.5 %
:PROS 77->89|PS00760|SPASE_I_2
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80021.1 GT:GENE sipS.1 GT:PRODUCT type I signal peptidase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 399764..400273 GB:FROM 399764 GB:TO 400273 GB:DIRECTION + GB:GENE sipS GB:PRODUCT type I signal peptidase GB:NOTE 169 aa, similar to sp:LEP_STAAU SIGNAL PEPTIDASE IB (EC 3.4.21.89) (SPASE IB) (LEADER PEPTIDASE IB) from Staphylococcus aureus (191 aa); 40% identity in 165 aa overlap. Putative N-terminal signal sequence was found by PSORT CPE0315 GB:PROTEIN_ID BAB80021.1 LENGTH 169 SQ:AASEQ MSKNLKEYVVIICAAIVLTLLINKFLLFKIVVPTPSMAPTIEPGDQLFATRIHNLSKMERGDMIVFYSKEFDERMIKRLIGLPGDKVEIKDDGTVNVNNEKLDEPYIKYPGGKVNMNFEVPEDKYLLLGDNRDNSKDARYWSDKYIDGDDILGKAQITVWPLNRFNFAS GT:EXON 1|1-169:0| BL:SWS:NREP 1 BL:SWS:REP 1->167|LEP_STAAR|3e-28|40.5|163/191| PROS 77->89|PS00760|SPASE_I_2|PDOC00418| TM:NTM 1 TM:REGION 10->32| BL:PDB:NREP 1 BL:PDB:REP 32->87,106->160|1t7dB|3e-07|41.1|107/223| RP:PDB:NREP 1 RP:PDB:REP 43->167|1b12A|6e-16|18.9|122/239| RP:PFM:NREP 2 RP:PFM:REP 31->97|PF00717|8e-08|41.8|67/70|Peptidase_S24| RP:PFM:REP 75->160|PF10502|1e-13|49.4|77/101|Peptidase_S26| HM:PFM:NREP 3 HM:PFM:REP 32->99|PF00717|7.3e-19|41.5|65/70|Peptidase_S24| HM:PFM:REP 74->142|PF10502|8.6e-08|25.0|68/138|Peptidase_S26| HM:PFM:REP 5->31|PF06143|7.7e-05|25.9|27/84|Baculo_11_kDa| RP:SCP:NREP 1 RP:SCP:REP 25->138|1b12A|3e-12|24.1|112/239|b.87.1.2| HM:SCP:REP 23->168|1b12A_|3.2e-39|41.7|144/247|b.87.1.2|1/1|LexA/Signal peptidase| OP:NHOMO 641 OP:NHOMOORG 367 OP:PATTERN -------------------------------------------------------------------- 21311--------------------------------1---1-111211111-221231122-1---333--11112211211--11-------------------------------------------------11111111214332333112222122222222222222222222222-----11-113445456564555685213324556223231133333353211111111111111233313-2111111112211111111-1----1-1-----------------1111111111111-22---222-1332422222223231333244351413323113311111111111111--11---------11--------------------------------1--111-------------------------------------------11-----11-111--11-1--1----1-----------------------1---------1-------------1------------1---------------131111111111111-11211211------12-------------------------------111-11--------1-----1-1------111--------------------------------------------------------------------------------------------1-----1111---111-------------------------1-222211-1-111111111111111111--------------11---------------1------------------------------111----------1---1-1-1--- ------------------------------------------------------------------------------------------------------------2--------------------------------------------1----1----------------11-161--113343-34121---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 159 STR:RPRED 94.1 SQ:SECSTR #######EEEEEEEcTTcEEEEETcEEccccccccTTTTTcccEEEEEEEEEEcGGGccEEEEEEEccTTcccTTEEEEEEEEEEETTEEEEEEEEcTTccccGGGccccTTccTTEEEccTTEEEEEcccTTccccHHHHc#ccEEGGGEEEEEEEEEEEcccccG## PSIPRED ccHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEcccccccccccccEEEEEEEcccccccccEEEEEEcccccccEEEEEEEEcccEEEEEcccEEEEccccccccccccccccccEEEEcccccEEEEcccccccccccccccEEccHHHEEEEEEEEEEcHHHHcccc //