[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : sipS.2
DDBJ      :sipS         probable type I signal peptidase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  306/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
b.87.1
:180 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->100,128->166 3iiqB PDBj 3e-09 50.0 %
:RPS:PDB   89->180 1b12A PDBj 1e-14 25.6 %
:RPS:SCOP  30->152 1jhcA  b.87.1.1 * 5e-13 8.6 %
:HMM:SCOP  38->179 1b12A_ b.87.1.2 * 1.2e-37 41.4 %
:RPS:PFM   47->100 PF00717 * Peptidase_S24 1e-08 44.4 %
:RPS:PFM   88->167 PF10502 * Peptidase_S26 1e-13 46.2 %
:HMM:PFM   46->111 PF00717 * Peptidase_S24 2e-18 43.8 64/70  
:HMM:PFM   87->150 PF10502 * Peptidase_S26 4.9e-07 28.1 64/138  
:HMM:PFM   21->58 PF09930 * DUF2162 0.00047 26.3 38/224  
:BLT:SWISS 18->179 LEP2_SYNY3 2e-20 35.0 %
:PROS 90->102|PS00760|SPASE_I_2
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80136.1 GT:GENE sipS.2 GT:PRODUCT probable type I signal peptidase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(550703..551245) GB:FROM 550703 GB:TO 551245 GB:DIRECTION - GB:GENE sipS GB:PRODUCT probable type I signal peptidase GB:NOTE 180 aa, similar to sp:LEPU_BACSU SIGNAL PEPTIDASE I U (EC 3.4.21.89) (SPASE I) (LEADER PEPTIDASE I) from Bacillus subtilis (187 aa); 35% identity in 143 aa overlap. Putative N-terminal signal sequence was found by PSORT. putative transmembrane region was found by PSORT CPE0430 GB:PROTEIN_ID BAB80136.1 LENGTH 180 SQ:AASEQ MNLLSESNISTLNKKSHLKIKNLILFSVIVFLGSYFLTNYLIFKAYIPTGSMRPTIMEEDEVIVSKIYTSINRGDIFVFSHESSEELLIKRVVGLPGEKVELKDGLLYVNDVFIDEPYVKNNESMNKTFYVPEGNYLFFGDNRARSEDARRWENPYVPKKNLDGKALFTVYPKDRIGFLK GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 18->179|LEP2_SYNY3|2e-20|35.0|157/218| PROS 90->102|PS00760|SPASE_I_2|PDOC00418| TM:NTM 1 TM:REGION 21->43| BL:PDB:NREP 1 BL:PDB:REP 47->100,128->166|3iiqB|3e-09|50.0|91/224| RP:PDB:NREP 1 RP:PDB:REP 89->180|1b12A|1e-14|25.6|90/239| RP:PFM:NREP 2 RP:PFM:REP 47->100|PF00717|1e-08|44.4|54/70|Peptidase_S24| RP:PFM:REP 88->167|PF10502|1e-13|46.2|78/101|Peptidase_S26| HM:PFM:NREP 3 HM:PFM:REP 46->111|PF00717|2e-18|43.8|64/70|Peptidase_S24| HM:PFM:REP 87->150|PF10502|4.9e-07|28.1|64/138|Peptidase_S26| HM:PFM:REP 21->58|PF09930|0.00047|26.3|38/224|DUF2162| RP:SCP:NREP 1 RP:SCP:REP 30->152|1jhcA|5e-13|8.6|105/130|b.87.1.1| HM:SCP:REP 38->179|1b12A_|1.2e-37|41.4|140/247|b.87.1.2|1/1|LexA/Signal peptidase| OP:NHOMO 610 OP:NHOMOORG 326 OP:PATTERN -------------------------------------------------------------------- 3131-------------------------------------1-1---1-----11-111121----------11112211211-----------------------------------------------------11111111214332333112222211122222222212122212122-----11-113455566564555685213324556223231133333323222222222222222233324-2111112221111--2-1-12---111--------------------------------44---444-13324222222232313332443514-232311331111121111111---1----11-11---1----------111111111-1----------------------------------------------------------------------11-----1------1------------------------11--------1------11-----1----------2-----------------131111111111111-11211211------12-------------------------------111-11--1111--1111--111--1---1-1--------------------------------------------------------------------------------------------1-111111111----1-------------------------1-2222-111--------------------------------------------------1--11--------------------------111---------------------- ------------------------------------------------------------------------------------------------------------1-------------------------------------------------1----------------1111611-112344-3312----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 77.8 SQ:SECSTR #######################################EETTTTEEEEEccccEEEcccEEEEEEEEccccEEEEccTTcccTTEEEEEEEEEEEEEETTEEEEEEEcTTccccGGGccccTTccTEEEccTTEEEEEcccTTccccHHHHc#TcEEGGGEEEEEEEEEEEcccccGGG DISOP:02AL 1-6, 8-18| PSIPRED cccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEcccccccccccccEEEEEEEEccccccEEEEEccccccccEEEEEEEccccEEEEEccEEEEccccccccccccccccccEEEEEccEEEEEEcccccccccHHcccccccHHHEEEEEEEEEEcHHHEEEcc //