[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : spmA
DDBJ      :spmA         spore maturation protein A
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  166/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:192 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   17->87 PF06122 * TraH 7e-04 29.6 %
:HMM:PFM   42->151 PF07670 * Gate 1.5e-13 15.0 100/109  
:BLT:SWISS 1->155 SPMA_BACSU 3e-33 40.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB82239.1 GT:GENE spmA GT:PRODUCT spore maturation protein A GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2902735..2903313) GB:FROM 2902735 GB:TO 2903313 GB:DIRECTION - GB:GENE spmA GB:PRODUCT spore maturation protein A GB:NOTE 192 aa, similar to pir:S74647 spore maturation protein B from Synechocystis sp. (strain PCC 6803) (217 aa); 44.3% identity in 192 aa overlap. Putative N-terminal signal sequence and 3 putative transmembrane regions were found by PSORT. CPE2533 GB:PROTEIN_ID BAB82239.1 LENGTH 192 SQ:AASEQ MINYIWFAIIALGLIFSIMTGQGELITTGLTESSEGAVKFIISLVGIMCFWCGVMKIAENSGLTSKVAKLLNPILKKIFKESSHSDEAMGAIVMNLTANMFGLSNAATPLGIKAMSELNKINKEKDGRASNDMALFLVINAACIQLIPSTVISIRAAAGSSEPASIIIPAIICTFTACCVGIICCKILQRYF GT:EXON 1|1-192:0| BL:SWS:NREP 1 BL:SWS:REP 1->155|SPMA_BACSU|3e-33|40.9|154/100| TM:NTM 5 TM:REGION 1->23| TM:REGION 35->57| TM:REGION 89->111| TM:REGION 134->156| TM:REGION 165->187| SEG 156->172|aaagssepasiiipaii| RP:PFM:NREP 1 RP:PFM:REP 17->87|PF06122|7e-04|29.6|71/356|TraH| HM:PFM:NREP 1 HM:PFM:REP 42->151|PF07670|1.5e-13|15.0|100/109|Gate| OP:NHOMO 167 OP:NHOMOORG 166 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1111-111---1-11--11111--------------------------------------1---------------1-----1--------------------111111111111111111111111111111-1--------11------------------------------------------------------------------------------------------11211111111111111111111111--1--11111111111111111---------------------------------------------------------------------------------------------------------------------------------11111------------------------1111--1111-1111---1----1----1------------1---------------1-1------------1----------------------------------1----1111111111111111111----1-1--------------------------------------------------------------------------------------------1-----1111-1----------------------------1-11111111111111111----------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 118-128| PSIPRED cHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //