[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : spoIIIAG
DDBJ      :spoIIIAG     stage III sporulation protein AG
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  67/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:194 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->189 PF09581 * Spore_III_AF 1.8e-05 22.9 144/188  
:BLT:SWISS 22->193 SP3AG_BACSU 4e-10 30.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81533.1 GT:GENE spoIIIAG GT:PRODUCT stage III sporulation protein AG GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2103821..2104405) GB:FROM 2103821 GB:TO 2104405 GB:DIRECTION - GB:GENE spoIIIAG GB:PRODUCT stage III sporulation protein AG GB:NOTE 194 aa, similar to pir:B69712 mutants block sporulation after engulfment spoIIIAG from Bacillus subtilis (229 aa); 28% identity in 157 aa overlap. Putative N-terminal signal sequence was found by PSORT CPE1827 GB:PROTEIN_ID BAB81533.1 LENGTH 194 SQ:AASEQ MSKILKQKNITNLIILLLLVIMFYLVVSYFTGVNNITKSEKTNLEKVSKEDMNSNSQKDSEVLSYQEKQEKDLERILGKINGVGSVDVVINFQSSEVKVPAVDNSSQKSTTEETDSEGGTRVNSQETDGDKIVMSNSSNGSEPVILKTEKPEVLGVMVVAEGAEDSKIKYEITKAISSLYNISVDKVNVLAMKK GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 22->193|SP3AG_BACSU|4e-10|30.8|172/100| TM:NTM 1 TM:REGION 8->30| SEG 3->21|kilkqknitnliillllvi| SEG 109->120|stteetdseggt| HM:PFM:NREP 1 HM:PFM:REP 17->189|PF09581|1.8e-05|22.9|144/188|Spore_III_AF| OP:NHOMO 67 OP:NHOMOORG 67 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111-1111-111111-1---------1------------------------------------------------------------------------------------------11111111111111111111111111--1--1111111-1---111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 32-66, 101-131, 193-194| PSIPRED ccHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccEEEEEEEcccccEEEccccccccEEEEEEEccccEEEEEEcccccccEEEEEccccEEEEEEEEEccccHHHHHHHHHHHHHHHcccHHHEEEEEccc //