[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : spoVAC
DDBJ      :spoVAC       stage V sporulation protein AC
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  79/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.26.1
:155 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  12->105 1mjgM  e.26.1.3 * 5e-04 19.8 %
:RPS:PFM   27->144 PF03862 * SpoVA 3e-20 55.0 %
:HMM:PFM   28->145 PF03862 * SpoVA 2.5e-48 55.1 118/119  
:BLT:SWISS 8->146 SP5AC_BACSU 5e-29 41.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81753.1 GT:GENE spoVAC GT:PRODUCT stage V sporulation protein AC GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(2338709..2339176) GB:FROM 2338709 GB:TO 2339176 GB:DIRECTION - GB:GENE spoVAC GB:PRODUCT stage V sporulation protein AC GB:NOTE 155 aa, similar to gpu:AP001512_155 stage V sporulation protein AC from Bacillus halodurans (159 aa); 49.7% identity in 145 aa overlap. 3 putative transmembrane regions were found by PSORT. CPE2047 GB:PROTEIN_ID BAB81753.1 LENGTH 155 SQ:AASEQ MYENDKKIRTKFDQLEQQIRPKPKLLRNCIMAFIVGGLICVIGQFVRNTFLYYGFTEEQVSSLTPMTMVFLGALLTGLGLYDRIAAKAGAGTIVPITGFSNAMVSPAIEFKKEGFVMGVGAKMFTIAGPVLVYGTGTSVIVGLIYYLLLRVGIVG GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 8->146|SP5AC_BACSU|5e-29|41.0|139/150| TM:NTM 4 TM:REGION 24->46| TM:REGION 60->82| TM:REGION 89->110| TM:REGION 123->145| RP:PFM:NREP 1 RP:PFM:REP 27->144|PF03862|3e-20|55.0|111/112|SpoVA| HM:PFM:NREP 1 HM:PFM:REP 28->145|PF03862|2.5e-48|55.1|118/119|SpoVA| RP:SCP:NREP 1 RP:SCP:REP 12->105|1mjgM|5e-04|19.8|91/728|e.26.1.3| OP:NHOMO 175 OP:NHOMOORG 79 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------33133444434446644643211144443322--------34------------------------------------------------------------------------------------------22111111121112111221111111--1112211122112212212----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 8-10| PSIPRED ccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //