[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : spoVS
DDBJ      :spoVS        stage V sporulation protein S
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  106/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->84 2ek0A PDBj 2e-25 58.3 %
:RPS:PDB   1->86 2ek0A PDBj 6e-31 57.0 %
:RPS:PFM   2->84 PF04232 * SpoVS 2e-27 78.3 %
:HMM:PFM   1->86 PF04232 * SpoVS 2e-47 73.3 86/86  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81377.1 GT:GENE spoVS GT:PRODUCT stage V sporulation protein S GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1945779..1946039) GB:FROM 1945779 GB:TO 1946039 GB:DIRECTION - GB:GENE spoVS GB:PRODUCT stage V sporulation protein S GB:NOTE 86 aa, similar to >gpu:AP001515_109 stage V sporulation protein S from Bacillus halodurans (86 aa); 81.4% identity in 86 aa overlap. Putative N-terminal signal sequence was found by PSORT CPE1671 GB:PROTEIN_ID BAB81377.1 LENGTH 86 SQ:AASEQ MEVLKVSTKSNPNSVAGALAAIIKERNTVEIQAVGAGAINQAVKAIAIARGFVAPSGKDIVCIPAFTDIEIDGEERTAIKLIIQPR GT:EXON 1|1-86:0| BL:PDB:NREP 1 BL:PDB:REP 1->84|2ek0A|2e-25|58.3|84/90| RP:PDB:NREP 1 RP:PDB:REP 1->86|2ek0A|6e-31|57.0|86/90| RP:PFM:NREP 1 RP:PFM:REP 2->84|PF04232|2e-27|78.3|83/86|SpoVS| HM:PFM:NREP 1 HM:PFM:REP 1->86|PF04232|2e-47|73.3|86/86|SpoVS| OP:NHOMO 154 OP:NHOMOORG 109 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1111------------------------------------------------------11111---11-------------------------------------1111111-1112222222212222221111112221111111------11------------------------------------------------------------------------------------------21121111111111111111111--2--2--21111111231222321---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2222232333--- ------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------11--------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 86 STR:RPRED 100.0 SQ:SECSTR ccEEEEcTTccHHHHHHHHHHHHHHHcEEEEEEccHHHHHHHHHHHHHHHHHHGGGTEEEEEEEEEEEEEETTEEEEEEEEEEEEE DISOP:02AL 6-7| PSIPRED ccEEEEEccccccHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHEEEEEEcccccEEEEcccEEEEEEcccEEEEEEEEEEcc //