[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : thiG
DDBJ      :thiG         thiamin biosynthesis protein
Swiss-Prot:THIG_CLOPE   RecName: Full=Thiazole biosynthesis protein thiG;

Homologs  Archaea  0/68 : Bacteria  616/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.1.31
:254 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->234 2htmC PDBj 5e-47 41.9 %
:RPS:PDB   1->234 3cwnA PDBj 8e-15 16.1 %
:RPS:SCOP  4->234 1tygA  c.1.31.1 * 2e-71 41.1 %
:HMM:SCOP  2->240 1wv2A_ c.1.31.1 * 2.1e-73 47.7 %
:RPS:PFM   5->248 PF05690 * ThiG 2e-58 48.0 %
:HMM:PFM   6->248 PF05690 * ThiG 1.8e-107 55.6 243/247  
:BLT:SWISS 1->254 THIG_CLOPE e-126 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81307.1 GT:GENE thiG GT:PRODUCT thiamin biosynthesis protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1874173..1874937) GB:FROM 1874173 GB:TO 1874937 GB:DIRECTION - GB:GENE thiG GB:PRODUCT thiamin biosynthesis protein GB:NOTE 254 aa, similar to pir:B81307 thiG protein Cj1045c from Campylobacter jejuni (strain NCTC 11168) (258 aa); 54.8% identity in 252 aa overlap CPE1601 GB:PROTEIN_ID BAB81307.1 LENGTH 254 SQ:AASEQ MDKLIIGGIEIKNRLFVGSGKYPSNEIIKDVLEGSGSQVITLALRRVDLDNKEEDILQNIPKDVILLPNTSGATNAEEAIRIARIARAMGCGNWIKIEVISDSKYLLPDNEETIKATKVLADEGFIVLPYMCPDIYAGRRLIEAGAAAVMPLGAPIGSNRGLKTKELIQIMIDELDIPIIVDAGIGKPSQAMEAMEMGAAACLVNTAIASSEDPINMARAFKVAVEGGRLAYEAKMGRESKFGNASSPLTGFLD GT:EXON 1|1-254:0| SW:ID THIG_CLOPE SW:DE RecName: Full=Thiazole biosynthesis protein thiG; SW:GN Name=thiG; OrderedLocusNames=CPE1601; SW:KW Complete proteome; Cytoplasm; Flavoprotein; FMN;Thiamine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->254|THIG_CLOPE|e-126|100.0|254/254| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0009228|"GO:thiamin biosynthetic process"|Thiamine biosynthesis| SEG 76->88|aeeairiariara| SEG 191->201|ameamemgaaa| BL:PDB:NREP 1 BL:PDB:REP 1->234|2htmC|5e-47|41.9|234/241| RP:PDB:NREP 1 RP:PDB:REP 1->234|3cwnA|8e-15|16.1|223/316| RP:PFM:NREP 1 RP:PFM:REP 5->248|PF05690|2e-58|48.0|244/245|ThiG| HM:PFM:NREP 1 HM:PFM:REP 6->248|PF05690|1.8e-107|55.6|243/247|ThiG| GO:PFM:NREP 1 GO:PFM GO:0009228|"GO:thiamin biosynthetic process"|PF05690|IPR008867| RP:SCP:NREP 1 RP:SCP:REP 4->234|1tygA|2e-71|41.1|231/242|c.1.31.1| HM:SCP:REP 2->240|1wv2A_|2.1e-73|47.7|239/0|c.1.31.1|1/1|ThiG-like| OP:NHOMO 629 OP:NHOMOORG 622 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111221111--1-----111111--111111121111---111--1-11111111111-11-----11--11111---------------1111111111----------111111111111111111111111111111111111111111111-111111111111111111111111111111--1-------111--------------11111---------------------1------------------------------------------------11-11-----------1111111-1111-111---111--111---1-1--11111111111111111111111111111111111-11111111111-1111111--111111111-1----11111111111111111111111111111-------------------1111-1111111111111111111111111111111111-1111111111111112211111111111111111111----11111-111111111111211111111111111111111-1-------11111111111111111111111111111111111111--1111------1111-111111111111-111111111111111111111111111111111111111111111111111-111111111-111---111111111111111111------------111111111111111111111111111111--------11111111111111111111111111111111-----------------------------------------------------1-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1----1------------1-----1---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 99.2 SQ:SECSTR HHHHcccEEEccHHHHHHHHTcGGGHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHTTccccEEEEccGGGTTcHHHHHHHHHHHHHHHHHTTccGGGEcccEEEEEccHHHHHHHHHHHHTTccEEEEEEccHHHHHHHHHTTccEEEEccHHHHHHHHTcHHHHHHHHcccccccGGGcHHHHHHHHHHHHHHHTTcccEEEEcccccHHHHHHTTTccEEEEcHHHHHHHcHHHHHHHcHHHHHccHH## DISOP:02AL 241-242| PSIPRED cccEEEccEEEEcEEEEEEcccccHHHHHHHHHHHcccEEEEEEEEEcccccccccHHHHHcccEEcccccccccHHHHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHccHHEEcccccccccccccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHcHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEccc //