[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : virR
DDBJ      :virR         two-component response regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  364/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.23.1
:236 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->106 2qv0A PDBj 2e-09 33.0 %
:BLT:PDB   131->201 3bs1A PDBj 2e-05 33.3 %
:RPS:PDB   32->127 3cwoX PDBj 4e-14 15.6 %
:RPS:PDB   129->227 3d6wA PDBj 9e-18 26.5 %
:RPS:SCOP  2->121 1p2fA2  c.23.1.1 * 9e-15 27.7 %
:HMM:SCOP  1->127 1s8nA_ c.23.1.1 * 1.7e-18 28.6 %
:RPS:PFM   4->112 PF00072 * Response_reg 2e-08 35.9 %
:RPS:PFM   139->227 PF04397 * LytTR 6e-11 40.4 %
:HMM:PFM   138->227 PF04397 * LytTR 5.9e-26 38.9 90/98  
:HMM:PFM   4->116 PF00072 * Response_reg 2e-17 29.6 108/112  
:BLT:SWISS 4->224 YPDB_ECOL6 6e-21 31.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81207.1 GT:GENE virR GT:PRODUCT two-component response regulator GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1753301..1754011) GB:FROM 1753301 GB:TO 1754011 GB:DIRECTION - GB:GENE virR GB:PRODUCT two-component response regulator GB:NOTE 236 aa, similar to pir:S60139 virR protein from Clostridium perfringens (252 aa); 100% identity in 237 aa overlap CPE1501 GB:PROTEIN_ID BAB81207.1 LENGTH 236 SQ:AASEQ MFSIALCEDNSLQREELKNNLSKVLDEIGVEYKLLTFETGEDLLREYPENLDMLFLDIQMGELTGMETARKVRKYDDKVEIIFITALWDYIQKGYEVRAFRYLIKPVKFKELQEQVTACVENILHKRYTYITIKDKNNVLKIRTEDILFLETFERKVIIHTNSQDYIVKMSMNKLEKELNNKGFFRCHTSYIVNLIKIEEIKKDYLLINKFTLPVSKHRMKNLKLRLTSLLGDLIC GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 4->224|YPDB_ECOL6|6e-21|31.1|212/245| BL:PDB:NREP 2 BL:PDB:REP 4->106|2qv0A|2e-09|33.0|97/122| BL:PDB:REP 131->201|3bs1A|2e-05|33.3|69/103| RP:PDB:NREP 2 RP:PDB:REP 32->127|3cwoX|4e-14|15.6|96/236| RP:PDB:REP 129->227|3d6wA|9e-18|26.5|98/107| RP:PFM:NREP 2 RP:PFM:REP 4->112|PF00072|2e-08|35.9|103/111|Response_reg| RP:PFM:REP 139->227|PF04397|6e-11|40.4|89/97|LytTR| HM:PFM:NREP 2 HM:PFM:REP 138->227|PF04397|5.9e-26|38.9|90/98|LytTR| HM:PFM:REP 4->116|PF00072|2e-17|29.6|108/112|Response_reg| GO:PFM:NREP 3 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| RP:SCP:NREP 1 RP:SCP:REP 2->121|1p2fA2|9e-15|27.7|112/120|c.23.1.1| HM:SCP:REP 1->127|1s8nA_|1.7e-18|28.6|119/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 727 OP:NHOMOORG 366 OP:PATTERN -------------------------------------------------------------------- -14-1--------------------1----------11----------1---111--1--11---121--11------1131----112251-5------2D263L1F29-----------------------------------------------------------------------------------13343433434443341-2222443-1143112111133-122111212222222222223---11----11111111-1-11---32321211211221111111111111111111111112221112154354444554-4-4822123232--1-7B129871122323212--1-12-------------------1-------------------------------------------------------------------------------------------------------1----------------------1----------------------111--11111112------------------------2-----1-21-2----1-----3-------------------11-1---121--2-11--12222211111-11---12------1------2222-212222222222-22222222222221222222222211-111111111111111112212222--212222222222---1----------11-1-----------------------2------------------------------111322222112221121211-111111----22------------1-1-------------------------11-21-1----1- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 227 STR:RPRED 96.2 SQ:SECSTR cEEEEEEcccHHHHHHHHHHHHHHHHHHccEEEEEccccccTTHHHHHHHcccEEEEcccTTccHHHHHHHHHHHcccccEEEEcccHHHHHHHHHTTccEEEEcHHHHHcTHHHHHHHHHHTccccccEEEEEccccEEEEEGGGGEEEEEETTEEEEEEcccEEEEcccHHHHHHHccTTTEEEEETTEEEEGGGEEEEEcccEETTccEEEEcTTTHHHHHHHH######### PSIPRED ccEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccccEEEEEcccHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHHHHEEEEEcccEEEEEEcccEEEEEEEccEEEEEEccEEEEEEccHHHHHHHccccccEEEEcHHEEcHHHHHccccEEEEEcccEEEEEHHHHHHHHHHHHHHHHHHcc //