[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : virS
DDBJ      :virS         two-component sensor histidine kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.122.1
:440 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   234->440 2bu7A PDBj 3e-06 8.9 %
:RPS:SCOP  296->436 2c2aA2  d.122.1.3 * 1e-04 15.1 %
:HMM:SCOP  290->434 1id0A_ d.122.1.3 * 3.2e-08 18.0 %
:HMM:PFM   334->422 PF02518 * HATPase_c 2.8e-06 22.4 85/111  
:HMM:PFM   195->304 PF11873 * DUF3393 0.00019 18.6 102/204  
:BLT:SWISS 293->394 YR472_MIMIV 4e-04 27.5 %
:PROS 290->299|PS00659|GLYCOSYL_HYDROL_F5
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81206.1 GT:GENE virS GT:PRODUCT two-component sensor histidine kinase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1751985..1753307) GB:FROM 1751985 GB:TO 1753307 GB:DIRECTION - GB:GENE virS GB:PRODUCT two-component sensor histidine kinase GB:NOTE 440 aa, similar to pir:C55521 virS protein from Clostridium perfringens (440 aa); 85.7% identity in 440 aa overlap. 5 putative transmembrane regions were found by PSORT. CPE1500 GB:PROTEIN_ID BAB81206.1 LENGTH 440 SQ:AASEQ MLMNQMFWDFMENASMIIEWVSFYLIISQFSPKKRKNKQEVYSFIVIIIFSVLLKVLNVYPNERIVICFFIGLIYYKFNFRVNNIKCIMISLIFWLFMLTVEALSISFIVKINSLVNVSDLLGKNIYRMETMILSKVILISLIMVVRCLKFRVDIGKGDFIYILTPIATNIIIILVIFGYAFKGGREGFGDNVSIFFVSILLLLSNMSLMFIVSKIIKNNKLKLENEFIKDKLEMEYKYYSNLKDNQEKVKRLYHDIKNHIACIEGNNKETGIRKKYIDSLNSEIDKLNLGFNTGNEVLDVILNNKREKCMENNISLKVFIDFSKVNFIEYFDICTIFSNCIDNAIEACKKIKDNNRYISLKGNCVNNFYVIKIENSKTNKIKKLNGDFLTDKKDKFLHGIGLKNIRLALEKYNGEIIIEPLDDKFILKMLIPINQEKEA GT:EXON 1|1-440:0| BL:SWS:NREP 1 BL:SWS:REP 293->394|YR472_MIMIV|4e-04|27.5|102/1700| PROS 290->299|PS00659|GLYCOSYL_HYDROL_F5|PDOC00565| TM:NTM 7 TM:REGION 11->32| TM:REGION 41->61| TM:REGION 64->83| TM:REGION 89->109| TM:REGION 134->156| TM:REGION 161->183| TM:REGION 193->215| SEG 43->54|sfiviiifsvll| SEG 161->177|iyiltpiatniiiilvi| SEG 193->210|vsiffvsillllsnmslm| SEG 215->230|kiiknnklklenefik| RP:PDB:NREP 1 RP:PDB:REP 234->440|2bu7A|3e-06|8.9|203/358| HM:PFM:NREP 2 HM:PFM:REP 334->422|PF02518|2.8e-06|22.4|85/111|HATPase_c| HM:PFM:REP 195->304|PF11873|0.00019|18.6|102/204|DUF3393| RP:SCP:NREP 1 RP:SCP:REP 296->436|2c2aA2|1e-04|15.1|139/151|d.122.1.3| HM:SCP:REP 290->434|1id0A_|3.2e-08|18.0|139/146|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 90 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------1----------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------1---1----1-1--------------------1---1----------111-------------------------------------------11---111--52111111221-1-4533-222311-1-7C--212-------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 210 STR:RPRED 47.7 SQ:SECSTR ######################################################################################################################################################################################################################################cEcHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccTTcEEEEEHHHHHHHHHccEHHHHHHHHHHHcccccEEEEEEEcccTTcccEEEEHHHHHHHHHHHHHHHHHHHTTccccccEEEEEEEcccEEEEEEEEEEEcccHHHHHHHHTcTTTTcccccHHHHHHHHHHHTTcEEEEEEETTEEEEEEEEEccGGGcc DISOP:02AL 1-3, 391-394, 438-440| PSIPRED cccHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEccEEEEEEEccccccHHHHHccccEEEEcccccccHHHHHHHHHHHHccEEEEEEEccEEEEEEEEEEcHHHcc //