[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48561.1
DDBJ      :             metal dependent phosphohydrolase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  371/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.211.1d.133.1
:405 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   85->111 3hc1A PDBj 5e-04 51.9 %
:BLT:PDB   197->360 3d6vA PDBj 3e-04 29.4 %
:RPS:PDB   14->184 3ccgA PDBj 1e-10 13.1 %
:RPS:PDB   221->396 3dysA PDBj 2e-17 16.6 %
:RPS:SCOP  12->149 1dgjA4  d.133.1.1 * 1e-11 12.0 %
:RPS:SCOP  216->374 1dgjA4  d.133.1.1 * 6e-26 12.9 %
:HMM:SCOP  1->183 1xx7A_ a.211.1.1 * 2.4e-19 30.8 %
:HMM:SCOP  221->396 1xx7A_ a.211.1.1 * 1.6e-32 38.0 %
:RPS:PFM   26->142 PF01966 * HD 2e-09 31.5 %
:RPS:PFM   236->350 PF01966 * HD 3e-05 32.2 %
:HMM:PFM   29->141 PF01966 * HD 5.2e-15 31.4 105/118  
:HMM:PFM   235->354 PF01966 * HD 5.4e-18 35.5 110/118  
:BLT:SWISS 12->176 RPFG_XANC8 3e-10 26.0 %
:BLT:SWISS 222->364 RPFG_XANC8 2e-26 43.4 %
:REPEAT 2|5->173|212->387
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48561.1 GT:GENE ABO48561.1 GT:PRODUCT metal dependent phosphohydrolase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 16219..17436 GB:FROM 16219 GB:TO 17436 GB:DIRECTION + GB:PRODUCT metal dependent phosphohydrolase GB:NOTE PFAM: metal-dependent phosphohydrolase, HD sub domain SMART: metal-dependent phosphohydrolase, HD region KEGG: swo:Swol_2407 HD domain protein GB:PROTEIN_ID ABO48561.1 GB:DB_XREF GI:134050590 InterPro:IPR003607 InterPro:IPR006674 LENGTH 405 SQ:AASEQ MQHFLTNYYKLLSSLSLAMDFSTNGLMRHHQRVALISLQIGKLYGLNIYQQEKLFTAAILHDAGSSSWNEKDLLFDFFTTGTFKHCKKGYELFKNHSLFKSIADIVLYHHDRWDGRNNASGLKREEIPIESRIIHLSDRIDVLIREDIYILEQKEYICRQINQEKNKIFDPQLVEAFNDISNRECFWLDLHSPFLNEILSHHCPVITKELGLAEVLSVADTMSKVIDFKSPFTRRHSSGVANVASFLALKAGFSAEQCDIIKVAGLLHDLGKLGIPDSVLDKPGKLTKSEFNIMKRHTYYTYHILKMIDKFDTINHYASSHHETLSGRGYPFKLDGSDLENGARIVAVADIFSALTEIRPYRQAMEKAKVINILSNQVKAGAIDSELTSLLLANYEGAHILNEIS GT:EXON 1|1-405:0| BL:SWS:NREP 2 BL:SWS:REP 12->176|RPFG_XANC8|3e-10|26.0|165/378| BL:SWS:REP 222->364|RPFG_XANC8|2e-26|43.4|143/378| NREPEAT 1 REPEAT 2|5->173|212->387| SEG 72->83|dllfdffttgtf| BL:PDB:NREP 2 BL:PDB:REP 85->111|3hc1A|5e-04|51.9|27/296| BL:PDB:REP 197->360|3d6vA|3e-04|29.4|153/308| RP:PDB:NREP 2 RP:PDB:REP 14->184|3ccgA|1e-10|13.1|167/184| RP:PDB:REP 221->396|3dysA|2e-17|16.6|175/324| RP:PFM:NREP 2 RP:PFM:REP 26->142|PF01966|2e-09|31.5|111/117|HD| RP:PFM:REP 236->350|PF01966|3e-05|32.2|106/117|HD| HM:PFM:NREP 2 HM:PFM:REP 29->141|PF01966|5.2e-15|31.4|105/118|HD| HM:PFM:REP 235->354|PF01966|5.4e-18|35.5|110/118|HD| RP:SCP:NREP 2 RP:SCP:REP 12->149|1dgjA4|1e-11|12.0|134/596|d.133.1.1| RP:SCP:REP 216->374|1dgjA4|6e-26|12.9|155/596|d.133.1.1| HM:SCP:REP 1->183|1xx7A_|2.4e-19|30.8|156/0|a.211.1.1|1/2|HD-domain/PDEase-like| HM:SCP:REP 221->396|1xx7A_|1.6e-32|38.0|150/0|a.211.1.1|2/2|HD-domain/PDEase-like| OP:NHOMO 1606 OP:NHOMOORG 373 OP:PATTERN -------------------------------------------------------------------- 2A1-2----------11----1----------1111--111---1-----------------2---111-1---------2-21-2---------------------------------------------11-5-5445532342-11-11-2311-------21-1111------------9435289156-11111--1-111--112----11-1323223------96------------------------------------------------------------------------------------------6D39C45455763755-553122617--445BEEE8DDF4EDA87583--655-----------32211-1-112------------76569346-1---11211-331--1-------------------------1-E21--------------------------------1--1221-11121112222--3122221211-1311-2332522125--9--327227282--------1145K29B8A6DC5HIDDD1DGECCAF49334331766-------------------322----EA27632-3357B778774999587466HF---1124-----------1-------------------------------11--------------------------------1-1-111-1111---4---------116-5-------------------------242222-2114111-2111---------352328888744ADD22333333331111--E2332222--------321-------------------------8D1BB7AA99--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 396 STR:RPRED 97.8 SQ:SECSTR HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHTTTTTTccHHHHHHHHHHTTcccccHHHHHHHHHHTTccHHHHHHHHTTTTcccccHHHHHHHHHHHHcTTcccTTHHHHHHHHHHcHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHcGccHHHHHHHcccccccccccHHHHHHcHHHHHGGGHHHHTccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHTTTTcccccHHHHHHTTHHTTTccHHHHHHHHHHHHHHHcGGGTTTccHHHHHHHHHHHHHHHHTTcGGGHHHHHHHHHHHTTcccTTcHHHHHHHHHHHHHHHHTcHGGGccHHHHHHHHHHHHHHHH######### DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccHHHccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccHHHccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcc //