[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48565.1
DDBJ      :             L-aspartate aminotransferase / phosphoserine aminotransferase
Swiss-Prot:             

Homologs  Archaea  65/68 : Bacteria  456/915 : Eukaryota  162/199 : Viruses  0/175   --->[See Alignment]
c.67.1
:385 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->383 2z9vA PDBj 4e-54 35.7 %
:RPS:PDB   3->361 2bkwA PDBj 3e-38 25.9 %
:RPS:SCOP  3->361 2bkwA1  c.67.1.3 * 4e-64 29.7 %
:HMM:SCOP  3->366 2bkwA1 c.67.1.3 * 4.4e-107 42.6 %
:RPS:PFM   7->334 PF00266 * Aminotran_5 4e-19 26.6 %
:HMM:PFM   7->328 PF00266 * Aminotran_5 6.7e-50 23.0 317/371  
:BLT:SWISS 5->380 Y959_METJA 3e-86 42.4 %
:PROS 183->203|PS00595|AA_TRANSFER_CLASS_5

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48565.1 GT:GENE ABO48565.1 GT:PRODUCT L-aspartate aminotransferase / phosphoserine aminotransferase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 20292..21449 GB:FROM 20292 GB:TO 21449 GB:DIRECTION + GB:PRODUCT L-aspartate aminotransferase / phosphoserine aminotransferase GB:NOTE PFAM: aminotransferase, class V KEGG: chy:CHY_2699 soluble hydrogenase, 42 kDa subunit GB:PROTEIN_ID ABO48565.1 GB:DB_XREF GI:134050594 InterPro:IPR000192 LENGTH 385 SQ:AASEQ MMKDKKYLLIPGPTQVPPRVVEAMSRPIIGHRSAEFQGVVERVTGKLKKVFQTENHVFILGSSGTGALEAAVANLVNPGDKVLALSCGKFGERFRDLAKIYGGEVDFVDFGWGYDIDLNIVKKKLEENPDIKVVLATQNETSTGVQNDIEGLGKLVAQYEAVLAVDAVSGLAAIDLKTDEWHVDVVVSGSQKAFMLPPGLAFVSVSDKAWKKIEQNTSPKYYFDLLKAKKSIAKWNTAYTTPVTMVYGLEAALDMILEEGLDNVFARHKLLAKATRAAIQGLGLELLAPEDCASMAVTAVQAPMVVDADTLRKVLLRDYGVTFAGGQDMMKGKIFRIAHMGFADKMDVIIAISALEMALGKCGYKAELGAGVREAQMVFVGGDHA GT:EXON 1|1-385:0| BL:SWS:NREP 1 BL:SWS:REP 5->380|Y959_METJA|3e-86|42.4|375/385| PROS 183->203|PS00595|AA_TRANSFER_CLASS_5|PDOC00514| BL:PDB:NREP 1 BL:PDB:REP 4->383|2z9vA|4e-54|35.7|373/392| RP:PDB:NREP 1 RP:PDB:REP 3->361|2bkwA|3e-38|25.9|355/374| RP:PFM:NREP 1 RP:PFM:REP 7->334|PF00266|4e-19|26.6|323/359|Aminotran_5| HM:PFM:NREP 1 HM:PFM:REP 7->328|PF00266|6.7e-50|23.0|317/371|Aminotran_5| GO:PFM:NREP 1 GO:PFM GO:0008152|"GO:metabolic process"|PF00266|IPR000192| RP:SCP:NREP 1 RP:SCP:REP 3->361|2bkwA1|4e-64|29.7|354/381|c.67.1.3| HM:SCP:REP 3->366|2bkwA1|4.4e-107|42.6|359/0|c.67.1.3|1/1|PLP-dependent transferases| OP:NHOMO 990 OP:NHOMOORG 683 OP:PATTERN 1111112222222222-22221212111113221111111111111111111111111111211--11 122----------1------------------------------1-------1--1------1----1-1---------11-2211112211-1------------11-----------------11111-1111-111--111-132212211122222222211111212222222222222222211---1222222221222222211111222---31-1------32-11111111111111211111----------11----------111--------------------------------------------11-22222223222114221222-21--2-111221111112111111-121-111------1243311212111------------2232232212--111-112-1123-----433111122211111111222112-1------------------------------------11-13334443333344462333135343322-1----1---1-4-1111-1------------111---1-1--112211332-11111111-111111-11----------11111111111111--1-12--2-3-21111131111111111111---2--1--------11--1------------------------------21211---1-111111111111111-------------11111111--1----------112-2---------------11111--12--111111111-1111--------------31122222222222--11111221----11-1--------------1------------1-------1------1112211111211 ----11--21-1121-111111111111111111111111111111-111111111111111111-11111111111111111111---11111111111111211-2--444222111--12-11111171-1211---11111-11--1--111111211-222-12421121122-----333132122--22221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 383 STR:RPRED 99.5 SQ:SECSTR HHccccEEcccccccccHHHHHTTccccccTTcHHHHHHHHHHHHHTTccGGGTcEEEEEEccTTHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHTTcEEEEEccccTTccccHHHHHHHHHHccccEEEEEcEETTTTEEccHHHHHHHHHHHcTEEEEEcTTTTTTccccTTTTTccEEEEEcccHTcccccEEEEEEcHHHHHHTcHHHHccHHHHHHHHHHHTTcccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHTTTccEEccccccccTcccccEEEEcccHHHHHHHHHHHTTEEcccccTTTGGGEEEEccGGGTTTcTHHHHHHHHHHHTTcHHHHHcHcHHHHHHHHGGGHHH## DISOP:02AL 1-3,383-386| PSIPRED cccccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHcccccEEEEEEEEccccccEEccHHHHHHHHHHcccEEEEccccccccccccHHHccccEEEEEccccccccccEEEEEEcHHHHHHHHccccccccccHHHHccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHcccEEEEEccccccHHHHHHHHHHHccEEEEcccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccc //