[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48567.1
DDBJ      :             seryl-tRNA synthetase
Swiss-Prot:SYS_DESRM    RecName: Full=Seryl-tRNA synthetase;         EC=6.1.1.11;AltName: Full=Seryl-tRNA(Ser/Sec) synthetase;AltName: Full=Serine--tRNA ligase;         Short=SerRS;

Homologs  Archaea  55/68 : Bacteria  910/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
a.2.7d.104.1
:424 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->417 2dq3A PDBj e-135 58.1 %
:RPS:PDB   1->422 2dq0A PDBj e-113 45.4 %
:RPS:SCOP  113->422 1serA2  d.104.1.1 * 1e-58 40.8 %
:HMM:SCOP  1->112 1setA1 a.2.7.1 * 3.2e-36 54.5 %
:HMM:SCOP  113->423 1setA2 d.104.1.1 * 4.2e-104 46.6 %
:RPS:PFM   1->106 PF02403 * Seryl_tRNA_N 7e-20 50.0 %
:RPS:PFM   172->337 PF00587 * tRNA-synt_2b 1e-19 36.0 %
:HMM:PFM   172->343 PF00587 * tRNA-synt_2b 6.1e-42 28.0 168/173  
:HMM:PFM   1->107 PF02403 * Seryl_tRNA_N 1.6e-32 49.5 107/108  
:BLT:SWISS 1->424 SYS_DESRM 0.0 100.0 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48567.1 GT:GENE ABO48567.1 GT:PRODUCT seryl-tRNA synthetase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 23222..24496 GB:FROM 23222 GB:TO 24496 GB:DIRECTION + GB:PRODUCT seryl-tRNA synthetase GB:NOTE KEGG: chy:CHY_2697 seryl-tRNA synthetase TIGRFAM: seryl-tRNA synthetase PFAM: tRNA synthetase, class II (G, H, P and S); seryl-tRNA synthetase, class IIa GB:PROTEIN_ID ABO48567.1 GB:DB_XREF GI:134050596 InterPro:IPR002314 InterPro:IPR002317 InterPro:IPR006195 LENGTH 424 SQ:AASEQ MLDIKFVRSNPELVLEGLKKRGSDISLDEFLKLDSMRREKLVVAEQLKNTRNVVSQEIGKLKKAGQDAEEKTLEMRKVSQKIKDMDDEIRNIEEKLQEILLSIPNIPHESVPVGKDENDNVEIRRWGKPRGFEFEPKPHWDLGEDLNILDFERGGKVTGARFSFYKGMGARLERALINFMLDLHTREHGYTEIFPPFIVNGDSMLGTGQLPKFAEDMFKLEGLNYYLIPTAEVPVTNLYRDEILAEEQLPIYHCAYSACFRAEAGAAGRDTRGLIRQHQFNKVELVKFSKPEESFDELERLTANAEKILQALGLPYRVVLLSTGDMGFTSAKTYDLEVWLPSYNAYKEISSCSNFLDFQARRANIKYRPTPKSKPEFVHTLNGSGIAVGRALSAILENYQEADGSITVPPVLVPYMGGIERITL GT:EXON 1|1-424:0| SW:ID SYS_DESRM SW:DE RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.11;AltName: Full=Seryl-tRNA(Ser/Sec) synthetase;AltName: Full=Serine--tRNA ligase; Short=SerRS; SW:GN Name=serS; OrderedLocusNames=Dred_0015; SW:KW Aminoacyl-tRNA synthetase; ATP-binding; Complete proteome; Cytoplasm;Ligase; Nucleotide-binding; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->424|SYS_DESRM|0.0|100.0|424/424| GO:SWS:NREP 6 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| COIL:NAA 41 COIL:NSEG 1 COIL:REGION 63->103| BL:PDB:NREP 1 BL:PDB:REP 2->417|2dq3A|e-135|58.1|413/422| RP:PDB:NREP 1 RP:PDB:REP 1->422|2dq0A|e-113|45.4|421/447| RP:PFM:NREP 2 RP:PFM:REP 1->106|PF02403|7e-20|50.0|106/107|Seryl_tRNA_N| RP:PFM:REP 172->337|PF00587|1e-19|36.0|161/170|tRNA-synt_2b| HM:PFM:NREP 2 HM:PFM:REP 172->343|PF00587|6.1e-42|28.0|168/173|tRNA-synt_2b| HM:PFM:REP 1->107|PF02403|1.6e-32|49.5|107/108|Seryl_tRNA_N| GO:PFM:NREP 12 GO:PFM GO:0000166|"GO:nucleotide binding"|PF02403|IPR015866| GO:PFM GO:0004828|"GO:serine-tRNA ligase activity"|PF02403|IPR015866| GO:PFM GO:0005524|"GO:ATP binding"|PF02403|IPR015866| GO:PFM GO:0005737|"GO:cytoplasm"|PF02403|IPR015866| GO:PFM GO:0006412|"GO:translation"|PF02403|IPR015866| GO:PFM GO:0006434|"GO:seryl-tRNA aminoacylation"|PF02403|IPR015866| GO:PFM GO:0000166|"GO:nucleotide binding"|PF00587|IPR002314| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF00587|IPR002314| GO:PFM GO:0005524|"GO:ATP binding"|PF00587|IPR002314| GO:PFM GO:0005737|"GO:cytoplasm"|PF00587|IPR002314| GO:PFM GO:0006412|"GO:translation"|PF00587|IPR002314| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF00587|IPR002314| RP:SCP:NREP 1 RP:SCP:REP 113->422|1serA2|1e-58|40.8|306/311|d.104.1.1| HM:SCP:REP 1->112|1setA1|3.2e-36|54.5|110/110|a.2.7.1|1/1|tRNA-binding arm| HM:SCP:REP 113->423|1setA2|4.2e-104|46.6|307/0|d.104.1.1|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 1463 OP:NHOMOORG 1161 OP:PATTERN 1111111111111111111111111111111111---------1-111--111-11111111111111 1111111111111111111-11111111111111111111111211111111111111111111111211111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111221111111211111111111111211111111111111111111211111121112222111111112221111111111111111111111111111111111111111111111121222222212112111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111112111111111111111111111112111111211111-1111211111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111-11111111111111111111111111111111 2111222141112222222222222222222222222222222222322223232222222222222212222222222222222222-2422222222222233412226322431212212244-225M2-3351121322311221222132111322523321221122122222N2222243742422242222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 424 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHcHHHHHHHHHHHTcGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccTTccccccGGGcEEEEEEccEEEEccccccHHHHHHHTTcEEcHHHHHHTcTTccEEcHHHHHHHHHHHHHHHHHHHHHTTcEEEccccEEcHHHHHTTccTTHHHHTccccTTcccEEcccTHHHHHHTTTTEEEETTTccEEEEEEEEEEcccTTcccccccccccccEEEEEEEEEEEcTTTHHHHHHHHHHHHHHHHHHTTccEEEEEccGGGccccccEEEEEEEEETTTTEEEEEEEEEEcTTTTHHHHTEEEEccTTcccEEcEEEEEEEEEHHHHHHHHHHHcccTTccEEccGGGHHHHcccEEccc DISOP:02AL 51-74| PSIPRED cccHHHHHccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEccccHHccccccHHHHHHHcccccccccccccccccEEEccHHHHHHHHHHHHHHHHHHHHcccEEEccccEEcHHHHHHccccccccccEEEEccccEEEccccHHHHHHHHHcccccHHHccEEEEEEccEEccccccccccccccEEcHHHEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccEEEEHHHHHHccccEEEEEEEcccHHHHHHHccccEEEcccccEEEEEEEcccccHHHHHHHHHHHHEEcccccEEccHHHccccccEEEEcc //