[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48568.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.37.1
:243 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  176->233 1vr9A3  d.37.1.1 * 7e-07 20.7 %
:HMM:SCOP  172->230 1nf7A3 d.37.1.1 * 4.7e-06 23.7 %
:HMM:PFM   192->231 PF00571 * CBS 8e-08 32.5 40/57  
:HMM:PFM   21->73 PF12129 * Phtf-FEM1B_bdg 0.001 27.5 51/159  
:BLT:SWISS 169->230 Y1426_METJA 2e-05 30.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48568.1 GT:GENE ABO48568.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(24816..25547) GB:FROM 24816 GB:TO 25547 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO48568.1 GB:DB_XREF GI:134050597 LENGTH 243 SQ:AASEQ MDNEHNRFECGLKYIVLVNILIFLFFFFVQIVHVPIYHITDQQEYILHFAEKVNSSMVILFLSVVVFSTIVIAIVFRSNIKLNIKKDQLLVDVGIQEKDFSQGIDGIKKVVDEHGNIPLYNSEVYRQLTKDYIISEVNKEGKPERFITMESYLSGFMQLCESANCHNHNITPQNLKIDKVYAPTEYVQVGDQLLTIIKKMNKNKLSALPVVNKDGVMIGSINYLQVLKLVTDAAKQQKTASIN GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 169->230|Y1426_METJA|2e-05|30.6|62/168| TM:NTM 2 TM:REGION 13->35| TM:REGION 53->75| SEG 15->34|ivlvniliflffffvqivhv| HM:PFM:NREP 2 HM:PFM:REP 192->231|PF00571|8e-08|32.5|40/57|CBS| HM:PFM:REP 21->73|PF12129|0.001|27.5|51/159|Phtf-FEM1B_bdg| RP:SCP:NREP 1 RP:SCP:REP 176->233|1vr9A3|7e-07|20.7|58/121|d.37.1.1| HM:SCP:REP 172->230|1nf7A3|4.7e-06|23.7|59/0|d.37.1.1|1/1|CBS-domain| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,237-244| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccEEEEEccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccHHEEEHHHHHHHHHHHHHcccccccccccccEEEEEEEcHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEccHHHHHHHHHHHHHHHHHccccc //