[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48574.1
DDBJ      :             AAA ATPase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  144/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:266 amino acids
:PSIPRED
:RPS:PDB   46->258 2chgA PDBj 7e-06 17.4 %
:RPS:SCOP  31->266 1fnnA2  c.37.1.20 * 1e-08 16.2 %
:HMM:SCOP  40->264 1w5sA2 c.37.1.20 * 5.3e-22 27.1 %
:RPS:PFM   46->205 PF01637 * Arch_ATPase 4e-05 28.4 %
:HMM:PFM   46->137 PF07728 * AAA_5 2.8e-05 28.6 77/139  
:BLT:SWISS 1->265 GSPA_AERHY 7e-15 25.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48574.1 GT:GENE ABO48574.1 GT:PRODUCT AAA ATPase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 30849..31649 GB:FROM 30849 GB:TO 31649 GB:DIRECTION + GB:PRODUCT AAA ATPase GB:NOTE SMART: AAA ATPase KEGG: chy:CHY_2519 general secretion pathway domain protein GB:PROTEIN_ID ABO48574.1 GB:DB_XREF GI:134050603 InterPro:IPR003593 LENGTH 266 SQ:AASEQ MYKAFYSLSATPFTKDLKTSNSFASTSFTEVSARLDYLKKARGMGLLVGEPGAGKTFSLRNFAESLNPSLYKVIYFPLSTGTVMDFFRGLAIGLGEEPKFRKVDLFHQIQRAVLVYFRERKITPVFILDEMQMARNLFLHDLSILFNFGMDSESPFILILAGLPNLQSKLTLNHNRPISQRLIMRYKMEPLNKEEVANYIQHHMELAGARHQIFSEPAVSAITSHSRGWPHLINNLATNCLLSGYQMKKELIDEEVVRVAVQEMSM GT:EXON 1|1-266:0| BL:SWS:NREP 1 BL:SWS:REP 1->265|GSPA_AERHY|7e-15|25.9|263/547| RP:PDB:NREP 1 RP:PDB:REP 46->258|2chgA|7e-06|17.4|184/223| RP:PFM:NREP 1 RP:PFM:REP 46->205|PF01637|4e-05|28.4|155/208|Arch_ATPase| HM:PFM:NREP 1 HM:PFM:REP 46->137|PF07728|2.8e-05|28.6|77/139|AAA_5| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF01637|IPR011579| RP:SCP:NREP 1 RP:SCP:REP 31->266|1fnnA2|1e-08|16.2|235/276|c.37.1.20| HM:SCP:REP 40->264|1w5sA2|5.3e-22|27.1|218/0|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 317 OP:NHOMOORG 145 OP:PATTERN -------------------------------------------------------------------- --1--------------11-11----11111-5--1--11---------------------------------------------21---------------------------------------------------------------------------------------------------------2-------------------------56-----------------------------------------------------------------------------------------------------------------------------------4--2---1751--4-58------1--------------1-------1-----------------------------------------11-----1----------1------1-------------------------------111-------------------61------------C-----11111-111--1-M2111---------111113-17---21--1111-53523342922121116-------------------------12221323312212222222222221222232---1122--------------------------------------------------------------------------------------------1---------1-2---------------------------12--------------------------122222222222211-----------------------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHcccccccccccccHHHHcccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHcccccccccEEEEEEEcHHHHHHHcccccccHHHEEEEEEEcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcc //