[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48577.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:325 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   129->184 1biaA PDBj 1e-05 21.8 %
:RPS:SCOP  132->192 2a61A1  a.4.5.28 * 1e-05 21.7 %
:HMM:SCOP  127->191 1j5yA1 a.4.5.1 * 7.9e-07 27.7 %
:HMM:PFM   132->179 PF01047 * MarR 1.2e-06 34.0 47/59  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48577.1 GT:GENE ABO48577.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 35374..36351 GB:FROM 35374 GB:TO 36351 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: hch:HCH_01177 hypothetical protein GB:PROTEIN_ID ABO48577.1 GB:DB_XREF GI:134050606 LENGTH 325 SQ:AASEQ MKYMLEIYLKENIDENITIQPWDGKKKIPLFLLEIYNFYETKILGQHCIIIEILQEAPGIDTIKKHIKVINRTVEQNLVFYYKSISWFRRKSLIQNRVPFVVEDGQMYLPFLGLDLKNILYKQEKKITMFSSSTQLAFLYLLYNGNRTINATELAAVLNTSKMTASRSLNDLYNFGLLTYVICGETKRSKEYKRIGDPEYYNEGSRYLKNPVWKTVYTWKKIENSLVAGLEALSLISMMNPPRNPVIAISKERLSEIEPYLLKDRDRIIDEKLTEIEVWNYDPRILSKENYVDLASLALSLKGINDERIEQALEERLKGEKWYMG GT:EXON 1|1-325:0| RP:PDB:NREP 1 RP:PDB:REP 129->184|1biaA|1e-05|21.8|55/292| HM:PFM:NREP 1 HM:PFM:REP 132->179|PF01047|1.2e-06|34.0|47/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 132->192|2a61A1|1e-05|21.7|60/139|a.4.5.28| HM:SCP:REP 127->191|1j5yA1|7.9e-07|27.7|65/65|a.4.5.1|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 15 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------1---2------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------2-----1-----------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------1--------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 23.7 SQ:SECSTR #######################################################################################################################GHHHHHHHHccccHHHHHHHHHHTTcccEccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEEEcTEEEE################################################################################################################################# DISOP:02AL 1-1,311-311,313-315| PSIPRED ccEEEEEEEcccccccEEEEEccccccccEEEEEHHHHHHHHHcccccEEEEEHHHcccHHHHHHHHHHHHHHHHccEEEEEccccHHHHHHHHHccccEEEEcccEEHHHHccHHHHHHHHccccEEEEEccccEEEEEEEEccccccccHHHHHHHccccEEHHHHHHHHHHccHHHHHcccccccEEEEEEcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEHHHHHHHHHHHHHccHHHHHHHHEEEEEEccccEEEEccccccHHHHHHHHccccHHHHHHHHHHHHcccccccc //