[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48578.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:258 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->194 PF08843 * DUF1814 1.2e-06 25.7 148/233  
:BLT:SWISS 108->231 MUTS_ENTFA 2e-05 28.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48578.1 GT:GENE ABO48578.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 36336..37112 GB:FROM 36336 GB:TO 37112 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: hne:HNE_0290 hypothetical protein GB:PROTEIN_ID ABO48578.1 GB:DB_XREF GI:134050607 InterPro:IPR000437 LENGTH 258 SQ:AASEQ MVHGIEKFKEYFSDYTGQYVFIGGTACSILLEEIGVSFRSTKDLDMVLIIESLDEPFGIKFWEFIEDGGYEYRQKSTGKEHFYRFANPSKPGFPTMIELFSRKPEKMQLHFDSLVTPIHIGDDVASLSAILLNDAYYNLLFKGKILVDGYSVLEMEYIMLFKIRAWLDLTIRLEAGEQIDSKNVKKHKNDIFRLLVNLTPSSKIEVEDEIYEDINRFLEKITDDQPDLKNLGIKTVTFEELLNRIKELYIPMDKEGTL GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 108->231|MUTS_ENTFA|2e-05|28.1|121/100| HM:PFM:NREP 1 HM:PFM:REP 13->194|PF08843|1.2e-06|25.7|148/233|DUF1814| OP:NHOMO 22 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------1---2------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------1-----------------------11111111111-----------------------------------------------------------1-----------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------1-1--------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,257-259| PSIPRED cccHHHHHHHHHcccccEEEEEEccHHEEEEHHccccccccccEEEEEEEEcccccccccHHHHHHHccccccccccccEEEEEEcccccccccHHHHHHHccccccccccccEEEEEEEccccccEEEEEEcHHHHHHHHHHHHHcccEEEEccccEEEEHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccHHHcccccEEHHHHHHHHHHHHccccccccc //