[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48591.1
DDBJ      :             phosphoribulokinase/uridine kinase
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  634/915 : Eukaryota  61/199 : Viruses  0/175   --->[See Alignment]
c.37.1d.15.10d.67.1
:554 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   37->197 1nyrA PDBj 3e-14 28.3 %
:BLT:PDB   288->506 1ufqB PDBj 9e-09 24.6 %
:RPS:PDB   92->230 2cimB PDBj 3e-09 7.3 %
:RPS:PDB   256->307 3czpB PDBj 5e-04 21.2 %
:RPS:PDB   288->518 1a7jA PDBj 3e-18 15.6 %
:RPS:SCOP  3->61 1nyqA2  d.15.10.1 * 5e-07 20.3 %
:RPS:SCOP  66->197 1nyqA3  d.67.1.1 * 3e-16 27.7 %
:RPS:SCOP  256->316 1s9hA  c.37.1.20 * 4e-05 11.5 %
:RPS:SCOP  288->454 1rz3A  c.37.1.6 * 5e-23 20.3 %
:HMM:SCOP  3->61 1nyrA2 d.15.10.1 * 3.3e-05 27.1 %
:HMM:SCOP  64->235 1qf6A3 d.67.1.1 * 8.1e-29 27.3 %
:HMM:SCOP  207->325 1um8A_ c.37.1.20 * 0.00032 22.7 %
:HMM:SCOP  274->485 1rz3A_ c.37.1.6 * 1.1e-29 28.7 %
:RPS:PFM   288->491 PF00485 * PRK 9e-32 44.6 %
:HMM:PFM   288->486 PF00485 * PRK 2.3e-21 28.2 181/194  
:HMM:PFM   171->197 PF07973 * tRNA_SAD 1.1e-05 37.0 27/44  
:HMM:PFM   246->311 PF00437 * GSPII_E 9.3e-05 25.0 52/282  
:BLT:SWISS 1->197 SYT_THENN 2e-24 32.8 %
:BLT:SWISS 183->301 RPOC2_CYACA 5e-04 29.8 %
:BLT:SWISS 288->482 URK_UREU1 1e-13 32.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48591.1 GT:GENE ABO48591.1 GT:PRODUCT phosphoribulokinase/uridine kinase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 50452..52116 GB:FROM 50452 GB:TO 52116 GB:DIRECTION + GB:PRODUCT phosphoribulokinase/uridine kinase GB:NOTE PFAM: phosphoribulokinase/uridine kinase KEGG: tte:TTE1778 uridine kinase GB:PROTEIN_ID ABO48591.1 GB:DB_XREF GI:134050620 InterPro:IPR000764 InterPro:IPR006083 LENGTH 554 SQ:AASEQ MEIKVLLEGDQSFEVSQGTPVMELLKIRHKEGSVPVVAAFIDNVLKDLRTPLTSDCHVRFVDLTMPEGVRVYRRSVTALLMRAISEILPGSNAVIQHSLGNGIYGEIHYDRPLKDKDIARIERQMHYIIEADEPWVLMNLKKEDAERLLTEAGQTEKIQLLHYLPKEEIELYSCGGYYDLCHGALVPSTGILKNFRLRFYLPGFILELPNLESPSKIPPYIEQGKLANIHFEAKKWANILKVNNVVSLNDVVTKGDVGNLIRVSEAFHEKKIGEIADQISDNIDRIRIVLIAGPSSSGKTSFAQRLSTQLQVNGIRPVAISLDDYFVDREMTPRDEEGNYDFESIFSIDIALFNDHLIKLIQGEEIELPYFNFKTGKREYHGERLQLGSADLLVVEGIHGLNDMLTSSIPKGRKFKIYVSALTQINLDNQNRIPTTDVRLLRRIARDQRCRGRSAGETISMWSSVRRGEEKNIFPFQESADVMFNSALPYELAVLKSVVEPHLKQITPEYPEYAEAQRLLDFVSYFAPLGPDEVPLNSIVREFIGGSCFVGTVR GT:EXON 1|1-554:0| BL:SWS:NREP 3 BL:SWS:REP 1->197|SYT_THENN|2e-24|32.8|192/640| BL:SWS:REP 183->301|RPOC2_CYACA|5e-04|29.8|114/1269| BL:SWS:REP 288->482|URK_UREU1|1e-13|32.2|174/207| BL:PDB:NREP 2 BL:PDB:REP 37->197|1nyrA|3e-14|28.3|159/642| BL:PDB:REP 288->506|1ufqB|9e-09|24.6|199/208| RP:PDB:NREP 3 RP:PDB:REP 92->230|2cimB|3e-09|7.3|137/477| RP:PDB:REP 256->307|3czpB|5e-04|21.2|52/452| RP:PDB:REP 288->518|1a7jA|3e-18|15.6|212/279| RP:PFM:NREP 1 RP:PFM:REP 288->491|PF00485|9e-32|44.6|186/189|PRK| HM:PFM:NREP 3 HM:PFM:REP 288->486|PF00485|2.3e-21|28.2|181/194|PRK| HM:PFM:REP 171->197|PF07973|1.1e-05|37.0|27/44|tRNA_SAD| HM:PFM:REP 246->311|PF00437|9.3e-05|25.0|52/282|GSPII_E| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00485|IPR006083| GO:PFM GO:0008152|"GO:metabolic process"|PF00485|IPR006083| GO:PFM GO:0016301|"GO:kinase activity"|PF00485|IPR006083| RP:SCP:NREP 4 RP:SCP:REP 3->61|1nyqA2|5e-07|20.3|59/59|d.15.10.1| RP:SCP:REP 66->197|1nyqA3|3e-16|27.7|130/179|d.67.1.1| RP:SCP:REP 256->316|1s9hA|4e-05|11.5|61/268|c.37.1.20| RP:SCP:REP 288->454|1rz3A|5e-23|20.3|148/184|c.37.1.6| HM:SCP:REP 3->61|1nyrA2|3.3e-05|27.1|59/0|d.15.10.1|1/1|TGS-like| HM:SCP:REP 64->235|1qf6A3|8.1e-29|27.3|172/179|d.67.1.1|1/1|ThrRS/AlaRS common domain| HM:SCP:REP 207->325|1um8A_|0.00032|22.7|88/364|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 274->485|1rz3A_|1.1e-29|28.7|188/198|c.37.1.6|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 842 OP:NHOMOORG 699 OP:PATTERN -------------------------11-----------------------------------11---- 112-------------------------------------------1---------1---------------111111-11-11-1--33321222---21-12111--1-1111111111111-111-111111------111----------------------1----1111111111111-1-12211112222222222222222111222221112121111111231111111111111111--211---------------------11-111---------11-------------------------------2221222222221213222211122212112212222122111222221211-111111111111111111111111111111111-11111111111111111111111111112---1-11-111111111111111111111-111111111111111111111111-1-1--11111111111111111111111111111111111111111111111111112111121111111111111111111111111111111111111122221111----------------------11-11--2111-1111-1111111111111111----11111------1-111111222121111-111111111111111111111111121111111111111111111121122--212211111111--1111111111211111---11--1-1-111-111111111111111112111111111112111111111111-------11--11111111111111111111--11--------112211-1-----------------1112122222232-1- 1---22--2112112----1---1111------------------------------------1111-1---1-1-----1111-112---1-----------111-1-11-2--1---------3------------------------------------------11-12-212117111-2-124-61--2--11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 505-516| PSIPRED ccEEEEEccccEEEEcccccHHHHHHHHcccccccEEEEEEccEEEEcccccccccEEEEEEcccHHHHHHHHccHHHHHHHHHHHHccccEEEEEEcccccEEEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHccccEEEEEEEcccccEEEEEEEccEEEEccccccccccccccEEEEEEcccEEcccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHcccccccEEEEEcccccccHHHccHHHcccccccccccccHHHHHHHHHHHHcccEEEEEEEccccccccccccEEEEccccEEEEEcHHHcccccHHHHHHHcccEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccEEEEc //