[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48596.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.118.1c.37.1
:230 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   125->193 3ea5B PDBj 2e-04 8.7 %
:RPS:SCOP  12->51 1g3qA  c.37.1.10 * 5e-06 37.5 %
:RPS:SCOP  147->193 2bkuB1  a.118.1.1 * 5e-04 8.5 %
:HMM:SCOP  11->195 1ionA_ c.37.1.10 * 0.0003 21.6 %
:RPS:PFM   20->54 PF09140 * MipZ 4e-05 51.4 %
:HMM:PFM   16->77 PF12282 * H_kinase_N 0.00031 31.7 60/150  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48596.1 GT:GENE ABO48596.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 56188..56880 GB:FROM 56188 GB:TO 56880 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: chy:CHY_0042 hypothetical protein GB:PROTEIN_ID ABO48596.1 GB:DB_XREF GI:134050625 LENGTH 230 SQ:AASEQ MKKNGGGFAISARIVEAYVGEYASGKSEVAVNRALEIGRSGRKVNLVDLDIVEPCYTLRPIKKELEESGLTVIAWETKDTVGLGEAGNIIKPESRWALYREGDVILDIGYGVEGAKTLNLLEGVDETPELQIYAVLNAKRPMTSTVQEILDYIKELGPIHGLINNTHLGDETTPEVVQEGAQIIGEVSKILGIPVVVTTADQEVAKKIGQVDGMGNPVRPLTRYMPRTFW GT:EXON 1|1-230:0| RP:PDB:NREP 1 RP:PDB:REP 125->193|3ea5B|2e-04|8.7|69/859| RP:PFM:NREP 1 RP:PFM:REP 20->54|PF09140|4e-05|51.4|35/62|MipZ| HM:PFM:NREP 1 HM:PFM:REP 16->77|PF12282|0.00031|31.7|60/150|H_kinase_N| RP:SCP:NREP 2 RP:SCP:REP 12->51|1g3qA|5e-06|37.5|40/237|c.37.1.10| RP:SCP:REP 147->193|2bkuB1|5e-04|8.5|47/857|a.118.1.1| HM:SCP:REP 11->195|1ionA_|0.0003|21.6|171/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 43 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--1111111-1-11--------1--1--12---1121211111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------1111-111-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 45.2 SQ:SECSTR #########################################################################################ccHHHHHHHHHHHHHHHHHHHHHHHHTTTcHHHHGHTcHHHHHHHHHHHHHHHHHcTTcTTGGGGGcHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHTc##################################### DISOP:02AL 1-6| PSIPRED cccccccEEEHHHHHHHHHHcccccccEEEEEEEHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHcccEEEEEEEccEEEEccccccccHHHHHHHHccccEEEEEccccHHHHHHHHHHccccccccEEEEEEEccccccccHHHHHHHHHHHcccccEEEcccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHHHHcccccccEEEEEccccccc //