[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48601.1
DDBJ      :             spore germination protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:359 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->182 PF03845 * Spore_permease 4e-13 28.2 %
:HMM:PFM   5->320 PF03845 * Spore_permease 3e-42 25.8 314/320  
:BLT:SWISS 1->335 GERKB_BACSU 5e-20 22.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48601.1 GT:GENE ABO48601.1 GT:PRODUCT spore germination protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(59762..60841) GB:FROM 59762 GB:TO 60841 GB:DIRECTION - GB:PRODUCT spore germination protein GB:NOTE TIGRFAM: spore germination protein PFAM: Spore germination protein KEGG: mta:Moth_1460 spore germination protein GB:PROTEIN_ID ABO48601.1 GB:DB_XREF GI:134050630 InterPro:IPR004761 LENGTH 359 SQ:AASEQ MQNQYISPKQCFLLLVGFTIGTATILVPTSAAALAHQDSWMTPPLAAIPGLGLVAMLVALNRRFPGQSLVQYSSSILGIPGKLLGLLTIWFAFHLSSLVLRNIGSYIHVAVLFETPLWVTHLFIVTLGTFALRLGIETITRAFSILMLLNIPFYLIIITFSTKTAKLDNLLPVLSHGWAPVIHASLNQATFPMGEIVLFGMVIFHIKDIKNLNLYLSTGLLTTALAGVFALATPVIVLGADMVARTADAVLISVTNASGSNLIVPLLALSWFIFSVCKFLICYYAFVLSASHWARLSDYKPLIFPAGALIMVYSIIAYSNTIEEAEFAKRIWTVYAIPFEYGIPLVLLIAAVVRAKGKG GT:EXON 1|1-359:0| BL:SWS:NREP 1 BL:SWS:REP 1->335|GERKB_BACSU|5e-20|22.9|332/373| TM:NTM 10 TM:REGION 10->32| TM:REGION 40->61| TM:REGION 75->97| TM:REGION 109->131| TM:REGION 141->163| TM:REGION 220->242| TM:REGION 245->267| TM:REGION 274->296| TM:REGION 299->321| TM:REGION 333->354| SEG 73->89|sssilgipgkllgllti| SEG 218->233|tgllttalagvfalat| RP:PFM:NREP 1 RP:PFM:REP 6->182|PF03845|4e-13|28.2|177/319|Spore_permease| HM:PFM:NREP 1 HM:PFM:REP 5->320|PF03845|3e-42|25.8|314/320|Spore_permease| GO:PFM:NREP 2 GO:PFM GO:0009847|"GO:spore germination"|PF03845|IPR004761| GO:PFM GO:0016021|"GO:integral to membrane"|PF03845|IPR004761| OP:NHOMO 54 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----1-22-2-1111222-1---111----------46-------------------------------------------------------------------------------------------211-----------1--------1------2-223111-1-2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,359-360| PSIPRED ccHHHccHHHHHHHHHHHHHHHHHHHHHcHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccc //