[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48606.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->65 PF10764 * Gin 1e-07 53.3 %
:HMM:PFM   17->65 PF10764 * Gin 5.2e-22 56.5 46/46  
:BLT:SWISS 18->67 CSFB_BACSU 6e-09 51.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48606.1 GT:GENE ABO48606.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 65437..65658 GB:FROM 65437 GB:TO 65658 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: tte:TTE0092 sigma-F transcribed protein CsfB GB:PROTEIN_ID ABO48606.1 GB:DB_XREF GI:134050635 LENGTH 73 SQ:AASEQ MIINRAGGLVLMQEKSKCVLCKAAVQETNIGIRILGKYICTSCEQKIINLSWDDPDYEAYKSGLKKIWRFNEA GT:EXON 1|1-73:0| BL:SWS:NREP 1 BL:SWS:REP 18->67|CSFB_BACSU|6e-09|51.1|47/100| RP:PFM:NREP 1 RP:PFM:REP 18->65|PF10764|1e-07|53.3|45/46|Gin| HM:PFM:NREP 1 HM:PFM:REP 17->65|PF10764|5.2e-22|56.5|46/46|Gin| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,73-74| PSIPRED ccccccccEEEEEEccEEEEEccccccccHHHHHHHHHHcHHHHHHHHccccccccHHHHHHHHHHHHHcccc //