[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48614.1
DDBJ      :             transcriptional regulator, AbrB family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  87/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.129.1
:86 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->50 1yfbA PDBj 6e-22 92.0 %
:RPS:PDB   1->52 1ektA PDBj 1e-12 88.5 %
:RPS:SCOP  1->50 1yfbA1  b.129.1.3 * 4e-22 92.0 %
:HMM:SCOP  1->51 1yfbA1 b.129.1.3 * 1e-13 54.9 %
:RPS:PFM   9->49 PF04014 * SpoVT_AbrB 1e-04 48.8 %
:HMM:PFM   8->50 PF04014 * SpoVT_AbrB 5.7e-15 46.5 43/47  
:HMM:PFM   52->70 PF06397 * Desulfoferrod_N 0.00067 47.4 19/36  
:BLT:SWISS 1->60 ABRB_BACSU 2e-22 83.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48614.1 GT:GENE ABO48614.1 GT:PRODUCT transcriptional regulator, AbrB family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(71256..71516) GB:FROM 71256 GB:TO 71516 GB:DIRECTION - GB:PRODUCT transcriptional regulator, AbrB family GB:NOTE TIGRFAM: transcriptional regulator, AbrB family PFAM: SpoVT/AbrB domain protein KEGG: chy:CHY_2622 transcriptional regulator, AbrB family GB:PROTEIN_ID ABO48614.1 GB:DB_XREF GI:134050643 InterPro:IPR006339 InterPro:IPR007159 LENGTH 86 SQ:AASEQ MKSTGIVRKVDELGRVVIPIELRRTLGIDEKDALEIYVDNEKIILRKYEPACVFCGNASDVTHYKGKMVCHECIAAMGESVKKEVV GT:EXON 1|1-86:0| BL:SWS:NREP 1 BL:SWS:REP 1->60|ABRB_BACSU|2e-22|83.3|60/96| BL:PDB:NREP 1 BL:PDB:REP 1->50|1yfbA|6e-22|92.0|50/52| RP:PDB:NREP 1 RP:PDB:REP 1->52|1ektA|1e-12|88.5|52/53| RP:PFM:NREP 1 RP:PFM:REP 9->49|PF04014|1e-04|48.8|41/45|SpoVT_AbrB| HM:PFM:NREP 2 HM:PFM:REP 8->50|PF04014|5.7e-15|46.5|43/47|SpoVT_AbrB| HM:PFM:REP 52->70|PF06397|0.00067|47.4|19/36|Desulfoferrod_N| RP:SCP:NREP 1 RP:SCP:REP 1->50|1yfbA1|4e-22|92.0|50/51|b.129.1.3| HM:SCP:REP 1->51|1yfbA1|1e-13|54.9|51/0|b.129.1.3|1/1|AbrB/MazE/MraZ-like| OP:NHOMO 232 OP:NHOMOORG 87 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------5233333354533545744344433332223211111111231-----------------------------------------------------------------------------------------25256232222222251222222312--21-4222423232222222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 52 STR:RPRED 60.5 SQ:SECSTR cccccEEEcccTTccccccHHHHHHHcccccccEEEEEETTEEEEEEccccc################################## DISOP:02AL 1-2,81-87| PSIPRED ccccccEEEEcccccEEEcHHHHHHcccccccEEEEEEEccEEEEEEcccccccccccccEEEEcccHHHHHHHHHHHHHHHHHcc //