[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48623.1
DDBJ      :             thiazole biosynthesis family protein
Swiss-Prot:THIG_DESRM   RecName: Full=Thiazole biosynthesis protein thiG;

Homologs  Archaea  0/68 : Bacteria  616/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.1.31
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->237 2htmC PDBj 1e-45 44.3 %
:RPS:PDB   69->249 1ec7A PDBj 5e-11 10.6 %
:RPS:SCOP  5->237 1tygA  c.1.31.1 * 5e-69 40.3 %
:HMM:SCOP  3->241 1wv2A_ c.1.31.1 * 3.1e-76 51.5 %
:RPS:PFM   7->249 PF05690 * ThiG 1e-52 47.3 %
:HMM:PFM   7->249 PF05690 * ThiG 1.2e-106 58.0 243/247  
:BLT:SWISS 1->257 THIG_DESRM e-121 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48623.1 GT:GENE ABO48623.1 GT:PRODUCT thiazole biosynthesis family protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 79870..80643 GB:FROM 79870 GB:TO 80643 GB:DIRECTION + GB:PRODUCT thiazole biosynthesis family protein GB:NOTE PFAM: thiazole biosynthesis family protein KEGG: mta:Moth_1663 thiazole biosynthesis GB:PROTEIN_ID ABO48623.1 GB:DB_XREF GI:134050652 InterPro:IPR008867 LENGTH 257 SQ:AASEQ MKEVFSVGGKELTSRLLIGSGKYSTNKLIPAILDASGSQVITMAMRRVDTEFTEENILNYIPSDCVLMPNTSGARNAQEAIRIARLARAAGCGDWVKIEVISDNRYLLPDNYETIRATEVLTAEGFQVFPYMSPDLMVAKELERVGAAAVMPLGAPIGSNRGLQTRELVRILIEEISLPVIVDAGIGRPSEAAEAMEMGAAAVLVNTAVATAKDPVAMARAFGLAVEAGRTAYLAGPGATQQVARASSPLTGFLREE GT:EXON 1|1-257:0| SW:ID THIG_DESRM SW:DE RecName: Full=Thiazole biosynthesis protein thiG; SW:GN Name=thiG; OrderedLocusNames=Dred_0073; SW:KW Complete proteome; Cytoplasm; Flavoprotein; FMN;Thiamine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->257|THIG_DESRM|e-121|100.0|257/257| GO:SWS:NREP 2 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0009228|"GO:thiamin biosynthetic process"|Thiamine biosynthesis| SEG 80->90|airiarlaraa| SEG 191->212|eaaeamemgaaavlvntavata| BL:PDB:NREP 1 BL:PDB:REP 3->237|2htmC|1e-45|44.3|235/241| RP:PDB:NREP 1 RP:PDB:REP 69->249|1ec7A|5e-11|10.6|179/429| RP:PFM:NREP 1 RP:PFM:REP 7->249|PF05690|1e-52|47.3|243/245|ThiG| HM:PFM:NREP 1 HM:PFM:REP 7->249|PF05690|1.2e-106|58.0|243/247|ThiG| GO:PFM:NREP 1 GO:PFM GO:0009228|"GO:thiamin biosynthetic process"|PF05690|IPR008867| RP:SCP:NREP 1 RP:SCP:REP 5->237|1tygA|5e-69|40.3|233/242|c.1.31.1| HM:SCP:REP 3->241|1wv2A_|3.1e-76|51.5|239/0|c.1.31.1|1/1|ThiG-like| OP:NHOMO 629 OP:NHOMOORG 622 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111221111--1-----111111--111111121111---111--1-11111111111-11-----11--11111---------------1111111111----------111111111111111111111111111111111111111111111-111111111111111111111111111111--1-------111--------------11111---------------------1------------------------------------------------11-11-----------1111111-1111-111---111--111---1-1--11111111111111111111111111111111111-11111111111-1111111--111111111-1----11111111111111111111111111111-------------------1111-1111111111111111111111111111111111-1111111111111112211111111111111111111----11111-111111111111211111111111111111111-1-------11111111111111111111111111111111111111--1111------1111-111111111111-111111111111111111111111111111111111111111111111111-111111111-111---111111111111111111------------111111111111111111111111111111--------11111111111111111111111111111111-----------------------------------------------------1-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1----1------------1-----1---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 251 STR:RPRED 97.7 SQ:SECSTR ##ccHcccEEEccHHHHHHHHTcGGGHHHHHGTcTTcHHHHHHHHHHHHHHTTccEEEEEEEcccHHHHTTcccccHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHcTHHcTTcEEEEEcTTcccHHHHHHHHHHTTTTEEEEEccccccTTccHHHHHHHHHHHHcccEEEccccccHHHHHHTcccEEcccHHHHcHHHHHHHHHHHHHTTcccccccccccHHHHHHHHHHHHTcccccc#### DISOP:02AL 1-1,243-243,257-258| PSIPRED ccccEEEccEEEEccEEEEccccccHHHHHHHHHHccccEEEEEEEEEEcccccccHHHHHccccEEcccccccccHHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHccccEEcccccccccccccccHHHHHHHHHHccccEEEEcccccccHHHHHHHHccHHEEEEHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHcccccccccEEccccc //