[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO48628.1
DDBJ      :             protein of unknown function DUF458
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  57/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:156 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   14->156 PF04308 * DUF458 1e-39 51.0 %
:HMM:PFM   14->156 PF04308 * DUF458 3e-65 62.2 143/144  
:BLT:SWISS 3->156 YKUK_BACSU 5e-27 45.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO48628.1 GT:GENE ABO48628.1 GT:PRODUCT protein of unknown function DUF458 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 84109..84579 GB:FROM 84109 GB:TO 84579 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF458 GB:NOTE PFAM: protein of unknown function DUF458 KEGG: chy:CHY_2615 hypothetical protein GB:PROTEIN_ID ABO48628.1 GB:DB_XREF GI:134050657 InterPro:IPR007405 LENGTH 156 SQ:AASEQ MNFISPTKGNMNFEEMLQDIVDYIKNLPCSSYKILVGTDSQVRRETCFVTAVIVHRRGKGARYYYCKNMQKKIISLRQKIFYETTMSLELGAKITSLLAEGGMEHLNVEIHIDVGNQGETKELIREVVGMVTGSGFEAKIKPDSFAASSVADRHTK GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 3->156|YKUK_BACSU|5e-27|45.8|153/100| RP:PFM:NREP 1 RP:PFM:REP 14->156|PF04308|1e-39|51.0|143/144|DUF458| HM:PFM:NREP 1 HM:PFM:REP 14->156|PF04308|3e-65|62.2|143/144|DUF458| OP:NHOMO 58 OP:NHOMOORG 57 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------1--11-----------------2---1---------------------------------------------------------------------------------1-1111111111111111--1111111-------------11-------------------------------------------------------------------------------------------1-1---------------------1--1--111111111111111-----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,156-157| PSIPRED ccEEccccccccHHHHHHHHHHHHHccccccEEEEEEEccccccccEEEEEEEEEEEEcccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccccHHHHHHHHHHHHHccccccEEcccHHHHHHHHHHHcc //